SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 156 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g44460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g44460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g44460

Feature Type:gene_model
Chromosome:Gm18
Start:54155005
stop:54160139
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G55520AT Annotation by Michelle Graham. TAIR10: TATA binding protein 2 | chr1:20726150-20727483 REVERSE LENGTH=200 SoyBaseE_val: 4.00E-135ISS
GO:0006352GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, initiation SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006367GO-bp Annotation by Michelle Graham. GO Biological Process: transcription initiation from RNA polymerase II promoter SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0017025GO-mf Annotation by Michelle Graham. GO Molecular Function: TBP-class protein binding SoyBaseN/AISS
KOG3302 KOG TATA-box binding protein (TBP), component of TFIID and TFIIIB JGI ISS
PTHR10126Panther TATA-BOX BINDING PROTEIN JGI ISS
PF00352PFAM Transcription factor TFIID (or TATA-binding protein, TBP) JGI ISS
UniRef100_P26357UniRef Annotation by Michelle Graham. Most informative UniRef hit: TATA-box-binding protein n=1 Tax=Solanum tuberosum RepID=TBP_SOLTU SoyBaseE_val: 2.00E-140ISS
UniRef100_UPI0001BA83F0UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001BA83F0 related cluster n=1 Tax=unknown RepID=UPI0001BA83F0 SoyBaseE_val: 3.00E-144ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g44460 not represented in the dataset

Glyma18g44460 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g41330 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Glyma19g28780 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g212300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g44460.1   sequence type=CDS   gene model=Glyma18g44460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGAACAAGCATTGGAAGGTAGCCAACCTGTGGATTTAACAAAGCACCCTTCTGGAATTGTGCCTACCCTTCAAAATATTGTGTCAACGGTCAGTTTGGACTGTAAGTTGGAGCTTAAATCAATTGCACTTCAAGCTCGTAATGCAGAATACAATCCCAAGCGTTTTGCTGCTGTTATTATGAGGATCAGGGAACCAAAAACTACTGCACTCATTTTTGCATCTGGCAAGATGGTCTGTACTGGAGCTAAGAGCGAGCAACAGTCTAAATTGGCGGCAAGGAAGTATGCTAGAATTATCCAAAAGCTTGGTTTCCCAGCTAAATTTAAGGATTTTAAGATTCAGAATATTGTTGGCTCTTGTGATGTAAAGTTCCCCATTCGACTGGAGGGTCTTGCCTATTCCCATGGTGCTTTCTCAAGTTATGAACCAGAGTTGTTTCCTGGACTAATCTATCGCATGAAGCAACCCAAGATAGTCTTGCTTATATTTGTCTCTGGAAAAATTGTTCTGACGGGAGCCAAGGTTAGAGATGAGACTTACACAGCCTTTGAGAACATATATCCAGTGCTTACTGAGTTCAGGAAAAACCAACAATGA

>Glyma18g44460.1   sequence type=predicted peptide   gene model=Glyma18g44460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEQALEGSQPVDLTKHPSGIVPTLQNIVSTVSLDCKLELKSIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEQQSKLAARKYARIIQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHGAFSSYEPELFPGLIYRMKQPKIVLLIFVSGKIVLTGAKVRDETYTAFENIYPVLTEFRKNQQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo