SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g44280

Feature Type:gene_model
Chromosome:Gm18
Start:53993827
stop:53995611
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g44280
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G40435AT Annotation by Michelle Graham. TAIR10: BEST Arabidopsis thaliana protein match is: transcription regulators (TAIR:AT3G56220.1); Has 289 Blast hits to 289 proteins in 30 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 289; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:16887048-16888407 FORWARD LENGTH=158 SoyBaseE_val: 4.00E-50ISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
UniRef100_B9S4A6UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9S4A6_RICCO SoyBaseE_val: 3.00E-51ISS
UniRef100_UPI000233E846UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E846 related cluster n=1 Tax=unknown RepID=UPI000233E846 SoyBaseE_val: 9.00E-103ISS

Expression Patterns of Glyma18g44280
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g44280
ParalogEvidenceComments
Glyma09g41470 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g44280 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g210700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g44280
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g44280
>Glyma18g44280.2   sequence type=CDS   gene model=Glyma18g44280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTACTTCTAGGGAGAAAAAAAGAGAGTCTCTGGAAGACACGTTGCAACAACTTCGCGATGTCACAAACTCCAGTGCTTTGAACAAAGCCTCAATTATTGTAGACGCCTCAAAATACATAGAGAAGTTGAAACAAAAAGTGGAGGGACTGAACTCAGAGCTGGGAATCGCGGATTCATCAACCTCTCAAATTGATGAACTGCCTATGGTAGTTGTGAAAACCCTAAAAAAGGGTTTCCTGATTAATGTGCTTTTAGAAAAGAATTTCCCTGGAATGCTCGTCTCTATACTCGAAACCTTCGAAGAACTGGGCCTTGATGTCCTTGATGCTAGGGTTTCTTGTGAAGACAGTTTCCAGCTAGAAGCTGTAGGAAGAGAAAGTCACAAGAACGACAGTGTTGACGCGCAAGTGGTAAAGCAAGCAGTGTTGCAAGCAATAAAGAACGTGGACTAA
Predicted protein sequences of Glyma18g44280
>Glyma18g44280.2   sequence type=predicted peptide   gene model=Glyma18g44280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASTSREKKRESLEDTLQQLRDVTNSSALNKASIIVDASKYIEKLKQKVEGLNSELGIADSSTSQIDELPMVVVKTLKKGFLINVLLEKNFPGMLVSILETFEELGLDVLDARVSCEDSFQLEAVGRESHKNDSVDAQVVKQAVLQAIKNVD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo