Glyma18g43870 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g43870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g43870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g43870

Feature Type:	gene_model
Chromosome:	Gm18
Start:	53454485
stop:	53455292
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g43870

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G53020	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein L24e family protein \| chr3:19660749-19661912 REVERSE LENGTH=163	SoyBase	E_val: 2.00E-29	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0009734	GO-bp	Annotation by Michelle Graham. GO Biological Process: auxin mediated signaling pathway	SoyBase	N/A	ISS
GO:0042254	GO-bp	Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis	SoyBase	N/A	ISS
GO:0048467	GO-bp	Annotation by Michelle Graham. GO Biological Process: gynoecium development	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0022625	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
PTHR10792	Panther	60S RIBOSOMAL PROTEIN L24	JGI		ISS
PF01246	PFAM	Ribosomal protein L24e	JGI		ISS
UniRef100_G5DWP4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L24-1 (Fragment) n=1 Tax=Silene latifolia RepID=G5DWP4_SILLA	SoyBase	E_val: 2.00E-32	ISS
UniRef100_I1N328	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N328_SOYBN	SoyBase	E_val: 1.00E-58	ISS

Expression Patterns of Glyma18g43870

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g43870 not represented in the dataset	Glyma18g43870 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g43870 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g43870

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g43870

Limit To All Plant Sequences

>Glyma18g43870.1   sequence type=CDS   gene model=Glyma18g43870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTTTCCTGTTTGCAAACTCAAAATGTAAGAGGTATTTCCACAATCGCCTGAAGCCTTCAAAGCTCACCTGGACTGCAGTGTACAGAAAGCAACACAAAAAGAAGATGAGATGTACTGCCAAAAAGCCTTACTCTAGGTCCATTGTTGCTGAGAAGCCAAAAGTTCGAGATGCAGCTAGGGAAGCTGTTCTTCAGGAAATTAAGAAGAGGATTAAGAAAACAAAGGATGAGAAGAAGACTAAGAAACCAAATACTGATATGAGGATTTTTGTTTGTTGA

Predicted protein sequences of Glyma18g43870

Limit To All Plant Sequences

>Glyma18g43870.1   sequence type=predicted peptide   gene model=Glyma18g43870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VFLFANSKCKRYFHNRLKPSKLTWTAVYRKQHKKKMRCTAKKPYSRSIVAEKPKVRDAAREAVLQEIKKRIKKTKDEKKTKKPNTDMRIFVC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain