SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g43760

Feature Type:gene_model
Chromosome:Gm18
Start:53319333
stop:53319804
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g43760
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20090AT Annotation by Michelle Graham. TAIR10: Uncharacterised protein family (UPF0041) | chr5:6787246-6788000 REVERSE LENGTH=110 SoyBaseE_val: 8.00E-49ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006301GO-bp Annotation by Michelle Graham. GO Biological Process: postreplication repair SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009060GO-bp Annotation by Michelle Graham. GO Biological Process: aerobic respiration SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
PTHR14154Panther UPF0041 BRAIN PROTEIN 44-RELATED JGI ISS
PTHR14154:SF3Panther UNCHARACTERIZED JGI ISS
PF03650PFAM Uncharacterised protein family (UPF0041) JGI ISS
UniRef100_B9RAJ4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Brain protein, putative n=1 Tax=Ricinus communis RepID=B9RAJ4_RICCO SoyBaseE_val: 4.00E-45ISS
UniRef100_I1N324UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N324_SOYBN SoyBaseE_val: 4.00E-54ISS

Expression Patterns of Glyma18g43760
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g43760
ParalogEvidenceComments
Glyma07g19230 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g43760 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g206700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g43760
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g43760
>Glyma18g43760.1   sequence type=CDS   gene model=Glyma18g43760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCCAATTTCCAAGCATTCTTGAACAACCCAGTTGGTCCAAAAACAACACATTTTTGGGGACCTATTGCCAATTGGGGATTTGTTGCTGCTGGTTTGATGGACATGATGAAAAAACCTCCCAAAATGATCTCTGGCAACATGACAGCAGCGATGTGCGTCTATTCAGCATTGTTCATGAGATTTGCATGGATGGTTCAACCGCGAAACTATCTGCTTCTTTCTTGCAATGCATCCAATGAAACTTAA
Predicted protein sequences of Glyma18g43760
>Glyma18g43760.1   sequence type=predicted peptide   gene model=Glyma18g43760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASNFQAFLNNPVGPKTTHFWGPIANWGFVAAGLMDMMKKPPKMISGNMTAAMCVYSALFMRFAWMVQPRNYLLLSCNASNET*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo