Glyma18g43721 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g43721

Feature Type:	gene_model
Chromosome:	Gm18
Start:	53284368
stop:	53288402
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g43721

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G18880	AT	Annotation by Michelle Graham. TAIR10: Nucleic acid-binding, OB-fold-like protein \| chr3:6509588-6510069 FORWARD LENGTH=105	SoyBase	E_val: 6.00E-46	ISS
GO:0006354	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0022627	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG1740	KOG	Predicted mitochondrial/chloroplast ribosomal protein S17	JGI		ISS
PTHR10744	Panther	40S RIBOSOMAL PROTEIN S11 FAMILY MEMBER	JGI		ISS
PF00366	PFAM	Ribosomal protein S17	JGI		ISS
UniRef100_C6SVD1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SVD1_SOYBN	SoyBase	E_val: 3.00E-67	ISS
UniRef100_G7JKN8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein S17 n=2 Tax=Medicago truncatula RepID=G7JKN8_MEDTR	SoyBase	E_val: 2.00E-54	ISS

Expression Patterns of Glyma18g43721

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g43721 not represented in the dataset	Glyma18g43721 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g43721

Paralog	Evidence	Comments
Glyma07g19190	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g43721 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g206300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g43721

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma18g43721

Limit To All Plant Sequences

>Glyma18g43721.2   sequence type=transcript   gene model=Glyma18g43721   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGTTTAATCATTTTAGGTCCAACGCTCCAAACCTCATTGTGTAGTCCTAACTCTTTTGTTTCTCATTTCGTTGAGTCGAAACAGCAGCTCCTCCGCCGTTGGTCCATCGCCGCCTCCTCCTCGTGCCACCGCCCTTGGGTGACGACGGAAAAGACGCAGAATTGGTCCTCCGTGGAATAGTCTCCGTTTCCCCGTTTTGGAATAATTTCCATCACTTCTCGTTGCTTTTGTTTTGTTCGAGGTTGGGAGGAGAAAATGAAGCAAGTTGTAGGAATGGTGGTTTCCAATAAGATGCAGAAATCAGTTGTGGTGGCAGTGGATAGACTTTTCTACCACAAATTGTATGATCGTTATGTCAAGCGCACCTCTAAATTCATGGCTCACGATGAGAACAACCTCTGTAACATTGGTGACAAAGTTCGACTGGATCCTTCTAGGCCTTTGAGCAAGCATAAACACTGGGTTGTTGCTGAAATTCTTAAGAAGGCACAGATATATGTTCCACTGTCCACGCCAGCATCTGATAATGTGAACTCCAGCTCTGTAGCACCAGCTTCATAAATTGGCTCAAGGTCTGAAATATATGAACTTAATTCTTTTTTTGAATACATCCTATTAGGATTGTATTCTGTTAAGATTTCATAATATTCCCCATACTCACGGAAAAGGTTACACTGTTGTGGACATGCTTTCTGTTTTTGGCATCACATGTTTCTACAGATTTCCTGTTTCCTTGTTGTCCTTGTTTTTTGTACTATTCTTACTTTACTCATTTCTTGTTCTCTAGTTTGTCATAC

Coding sequences of Glyma18g43721

Limit To All Plant Sequences

>Glyma18g43721.1   sequence type=CDS   gene model=Glyma18g43721   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCAAGTTGTAGGAATGGTGGTTTCCAATAAGATGCAGAAATCAGTTGTGGTGGCAGTGGATAGACTTTTCTACCACAAATTGTATGATCGTTATGTCAAGCGCACCTCTAAATTCATGGCTCACGATGAGAACAACCTCTGTAACATTGGTGACAAAGTTCGACTGGATCCTTCTAGGCCTTTGAGCAAGCATAAACACTGGGTTGTTGCTGAAATTCTTAAGAAGGCACAGATATATGTTCCACTGTCCACGCCAGCATCTGATAATGTGAACTCCAGCTCTGTAGCACCAGCTTCATAA

>Glyma18g43721.2   sequence type=CDS   gene model=Glyma18g43721   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCAAGTTGTAGGAATGGTGGTTTCCAATAAGATGCAGAAATCAGTTGTGGTGGCAGTGGATAGACTTTTCTACCACAAATTGTATGATCGTTATGTCAAGCGCACCTCTAAATTCATGGCTCACGATGAGAACAACCTCTGTAACATTGGTGACAAAGTTCGACTGGATCCTTCTAGGCCTTTGAGCAAGCATAAACACTGGGTTGTTGCTGAAATTCTTAAGAAGGCACAGATATATGTTCCACTGTCCACGCCAGCATCTGATAATGTGAACTCCAGCTCTGTAGCACCAGCTTCATAA

Predicted protein sequences of Glyma18g43721

Limit To All Plant Sequences

>Glyma18g43721.1   sequence type=predicted peptide   gene model=Glyma18g43721   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKQVVGMVVSNKMQKSVVVAVDRLFYHKLYDRYVKRTSKFMAHDENNLCNIGDKVRLDPSRPLSKHKHWVVAEILKKAQIYVPLSTPASDNVNSSSVAPAS*

>Glyma18g43721.2   sequence type=predicted peptide   gene model=Glyma18g43721   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKQVVGMVVSNKMQKSVVVAVDRLFYHKLYDRYVKRTSKFMAHDENNLCNIGDKVRLDPSRPLSKHKHWVVAEILKKAQIYVPLSTPASDNVNSSSVAPAS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain