Glyma18g43710 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g43710): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g43710): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g43710

Feature Type:	gene_model
Chromosome:	Gm18
Start:	53272887
stop:	53276307
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g43710

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G22110	AT	Annotation by Michelle Graham. TAIR10: 20S proteasome alpha subunit C1 \| chr3:7792819-7793571 REVERSE LENGTH=250	SoyBase	E_val: 3.00E-172	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0006096	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolysis	SoyBase	N/A	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0051603	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis involved in cellular protein catabolic process	SoyBase	N/A	ISS
GO:0000502	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005839	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome core complex	SoyBase	N/A	ISS
GO:0019773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome core complex, alpha-subunit complex	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0004175	GO-mf	Annotation by Michelle Graham. GO Molecular Function: endopeptidase activity	SoyBase	N/A	ISS
GO:0004298	GO-mf	Annotation by Michelle Graham. GO Molecular Function: threonine-type endopeptidase activity	SoyBase	N/A	ISS
GO:0008233	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peptidase activity	SoyBase	N/A	ISS
KOG0178	KOG	20S proteasome, regulatory subunit alpha type PSMA4/PRE9	JGI		ISS
PTHR11599	Panther	PROTEASOME SUBUNIT ALPHA/BETA	JGI		ISS
PTHR11599:SF13	Panther	PROTEASOME BETA/DELTA SUBUNIT	JGI		ISS
PF00227	PFAM	Proteasome subunit	JGI		ISS
PF10584	PFAM	Proteasome subunit A N-terminal signature	JGI		ISS
UniRef100_I1N318	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Proteasome subunit alpha type n=2 Tax=Glycine max RepID=I1N318_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_I1N318	UniRef	Annotation by Michelle Graham. Best UniRef hit: Proteasome subunit alpha type n=2 Tax=Glycine max RepID=I1N318_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma18g43710

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g43710 not represented in the dataset	Glyma18g43710 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g43710

Paralog	Evidence	Comments
Glyma07g19170	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g43710 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g206200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g43710

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma18g43710

Limit To All Plant Sequences

>Glyma18g43710.2   sequence type=transcript   gene model=Glyma18g43710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CGATCGCCGTCTTTGCCCTGCCCATTCCTGATATGATAGCCGTACTACAATCTTCTCCCCTGAAGGACGTCTTTACCAAGTGGAATATGCTATGGAGGCCATTGGGAATGCTGGTACTGCAATAGGGATCTTGTCAAAAGATGGGGTAGTTCTGGTTGGTGAGAAGAAAGTCACATCCAAGCTGCTGCAAACCTCAACTTCCACCGAGAAAATGTACAAGATTGATGATCATGTTGCATGTGCCGTGGCTGGAATTATGTCTGATGCTAACATCCTAATCAATACTGCTAGAGTTCAGGCACAGCGCTACACGTATGCTTACCAAGAGCCAATGCCGGTTGAGCAGTTGGTTCAATCTCTTTGTGACACTAAGCAAGGTTACACACAATTTGGTGGTCTTCGTCCATTTGGAGTCTCGTTCCTCTTTGCTGGCTGGGACAAGAATTTTGGCTTTCAACTTTACACTAGTGACCCCAGTGGAAATTATGGTGGTTGGAAAGCTGCAGCTATTGGTGCCAACAACCAGGCAGCACAGTCAATTCTGAAACAGGACTACAAGGATGATATCACAAGGGAAGAAGCAGTTCAACTTGCACTGAAGGTGCTAAGTAAAACTATGGACAGCACAAGTCTTACCTCTGAAAAGCTTGAGCTTGCAGAGGTATTTCTCTCACCCTCTGGAAAAGTCAAGTATCAAGTTTGCTCCCCAGAAAACCTGACTAAGCTGTTGGTGAAGTTTGGGGTGACTCAACCGGCAGCAGACACTGCTTAGCTTCTAGTTTCATGTAATATGCCGTTTAATTATGCCTATACAGTGCATTTGAACGTTCTTCCTTTCATAATAGACGTCAGAAAGTGTCCCATGTCCCAAATTTATTTCAAAGTTCAAACTTTAAGCATTGTGTATCTTGGTGTAATGCTAATTGCTTTTTAGTTCGTATTTGTTTT

Coding sequences of Glyma18g43710

Limit To All Plant Sequences

>Glyma18g43710.1   sequence type=CDS   gene model=Glyma18g43710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTCGAAGATATGATAGCCGTACTACAATCTTCTCCCCTGAAGGACGTCTTTACCAAGTGGAATATGCTATGGAGGCCATTGGGAATGCTGGTACTGCAATAGGGATCTTGTCAAAAGATGGGGTAGTTCTGGTTGGTGAGAAGAAAGTCACATCCAAGCTGCTGCAAACCTCAACTTCCACCGAGAAAATGTACAAGATTGATGATCATGTTGCATGTGCCGTGGCTGGAATTATGTCTGATGCTAACATCCTAATCAATACTGCTAGAGTTCAGGCACAGCGCTACACGTATGCTTACCAAGAGCCAATGCCGGTTGAGCAGTTGGTTCAATCTCTTTGTGACACTAAGCAAGGTTACACACAATTTGGTGGTCTTCGTCCATTTGGAGTCTCGTTCCTCTTTGCTGGCTGGGACAAGAATTTTGGCTTTCAACTTTACACTAGTGACCCCAGTGGAAATTATGGTGGTTGGAAAGCTGCAGCTATTGGTGCCAACAACCAGGCAGCACAGTCAATTCTGAAACAGGACTACAAGGATGATATCACAAGGGAAGAAGCAGTTCAACTTGCACTGAAGGTGCTAAGTAAAACTATGGACAGCACAAGTCTTACCTCTGAAAAGCTTGAGCTTGCAGAGGTATTTCTCTCACCCTCTGGAAAAGTCAAGTATCAAGTTTGCTCCCCAGAAAACCTGACTAAGCTGTTGGTGAAGTTTGGGGTGACTCAACCGGCAGCAGACACTGCTTAG

>Glyma18g43710.2   sequence type=CDS   gene model=Glyma18g43710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGCCATTGGGAATGCTGGTACTGCAATAGGGATCTTGTCAAAAGATGGGGTAGTTCTGGTTGGTGAGAAGAAAGTCACATCCAAGCTGCTGCAAACCTCAACTTCCACCGAGAAAATGTACAAGATTGATGATCATGTTGCATGTGCCGTGGCTGGAATTATGTCTGATGCTAACATCCTAATCAATACTGCTAGAGTTCAGGCACAGCGCTACACGTATGCTTACCAAGAGCCAATGCCGGTTGAGCAGTTGGTTCAATCTCTTTGTGACACTAAGCAAGGTTACACACAATTTGGTGGTCTTCGTCCATTTGGAGTCTCGTTCCTCTTTGCTGGCTGGGACAAGAATTTTGGCTTTCAACTTTACACTAGTGACCCCAGTGGAAATTATGGTGGTTGGAAAGCTGCAGCTATTGGTGCCAACAACCAGGCAGCACAGTCAATTCTGAAACAGGACTACAAGGATGATATCACAAGGGAAGAAGCAGTTCAACTTGCACTGAAGGTGCTAAGTAAAACTATGGACAGCACAAGTCTTACCTCTGAAAAGCTTGAGCTTGCAGAGGTATTTCTCTCACCCTCTGGAAAAGTCAAGTATCAAGTTTGCTCCCCAGAAAACCTGACTAAGCTGTTGGTGAAGTTTGGGGTGACTCAACCGGCAGCAGACACTGCTTAG

Predicted protein sequences of Glyma18g43710

Limit To All Plant Sequences

>Glyma18g43710.1   sequence type=predicted peptide   gene model=Glyma18g43710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGTAIGILSKDGVVLVGEKKVTSKLLQTSTSTEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYTYAYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNFGFQLYTSDPSGNYGGWKAAAIGANNQAAQSILKQDYKDDITREEAVQLALKVLSKTMDSTSLTSEKLELAEVFLSPSGKVKYQVCSPENLTKLLVKFGVTQPAADTA*

>Glyma18g43710.2   sequence type=predicted peptide   gene model=Glyma18g43710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEAIGNAGTAIGILSKDGVVLVGEKKVTSKLLQTSTSTEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYTYAYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNFGFQLYTSDPSGNYGGWKAAAIGANNQAAQSILKQDYKDDITREEAVQLALKVLSKTMDSTSLTSEKLELAEVFLSPSGKVKYQVCSPENLTKLLVKFGVTQPAADTA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain