SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g43591

Feature Type:gene_model
Chromosome:Gm18
Start:53179171
stop:53182248
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g43591
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G08880AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G01570.1); Has 177 Blast hits to 175 proteins in 60 species: Archae - 4; Bacteria - 33; Metazoa - 18; Fungi - 11; Plants - 59; Viruses - 0; Other Eukaryotes - 52 (source: NCBI BLink). | chr3:2703169-2704165 FORWARD LENGTH=201 SoyBaseE_val: 2.00E-46ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1N310UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1N310_SOYBN SoyBaseE_val: 4.00E-68ISS
UniRef100_Q01J37UniRef Annotation by Michelle Graham. Most informative UniRef hit: OSIGBa0140O07.6 protein n=4 Tax=Oryza sativa RepID=Q01J37_ORYSA SoyBaseE_val: 2.00E-38ISS

Expression Patterns of Glyma18g43591
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g43591 not represented in the dataset
Glyma18g43591 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g43591
ParalogEvidenceComments
Glyma07g18957 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g43591 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g205200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g43591
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g43591
>Glyma18g43591.1   sequence type=CDS   gene model=Glyma18g43591   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGAACCTTGGAGAAACATCGACGTGGAGAAGCTGATCTCGTACAGCGACGACCTCGTCAAGGTGTTGTCGGAGGGTCCGCGCGACCTCAACAACCTCTCTCACTCTCTCCAACAAACACGCGCCCTTTCTTCCTCCTGCGACTCCGACCTCAATGAAGCTCGCTCCTTCCTCCATGACTATCAGAACAAAGTAGATGCATGCAAGCAGAAAATAGAGGAAGCTAGATCCGAGACTGCTGCTGATGGAGACCTGGATCTTCTACAAAGAGAACTGGAGGAAGAACTTGAGAAAGAACGCTGGTTGAAAGAGGACATGTTTAATGATCTAGAACAGCAATGGATTTCTGTCCAAGAGCAAAAGAAGACCATACAGACAATTGAGAAAAATAAGCAGAGGACACAGATGGTACTTTCAATGTATGCTTCTGTCACAAATATTGTGCCTAACTTGGATGAACAGTCCAAAATTTCAGGCTATATTGTGGAAAAGGATAAAAACGCTGTTGAGAAGTTTGAATATGACACCTCAAATATGACTGCCCTTGATATATGTAATGGTATTTGGAAAATAATAAGTGAGTGA
Predicted protein sequences of Glyma18g43591
>Glyma18g43591.1   sequence type=predicted peptide   gene model=Glyma18g43591   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEPWRNIDVEKLISYSDDLVKVLSEGPRDLNNLSHSLQQTRALSSSCDSDLNEARSFLHDYQNKVDACKQKIEEARSETAADGDLDLLQRELEEELEKERWLKEDMFNDLEQQWISVQEQKKTIQTIEKNKQRTQMVLSMYASVTNIVPNLDEQSKISGYIVEKDKNAVEKFEYDTSNMTALDICNGIWKIISE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo