Report for Sequence Feature Glyma18g43530
Feature Type: gene_model
Chromosome: Gm18
Start: 53085588
stop: 53088869
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g43530
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G51780 AT
Annotation by Michelle Graham. TAIR10: BCL-2-associated athanogene 4 | chr3:19207029-19208178 REVERSE LENGTH=269
SoyBase E_val: 1.00E-51 ISS
GO:0009409 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cold
SoyBase N/A ISS
GO:0009651 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to salt stress
SoyBase N/A ISS
GO:0010228 GO-bp
Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0051087 GO-mf
Annotation by Michelle Graham. GO Molecular Function: chaperone binding
SoyBase N/A ISS
PTHR12329 Panther
BCL2-ASSOCIATED ATHANOGENE
JGI ISS
PTHR12329:SF9 Panther
JGI ISS
PF02179 PFAM
BAG domain
JGI ISS
UniRef100_G7KSC2 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: BAG-domain protein 1 / regulator of cell death n=2 Tax=Medicago truncatula RepID=G7KSC2_MEDTR
SoyBase E_val: 6.00E-65 ISS
UniRef100_I1N305 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N305_SOYBN
SoyBase E_val: 6.00E-141 ISS
Expression Patterns of Glyma18g43530
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma18g43530
Paralog Evidence Comments
Glyma07g18660 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g43530 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma18g43530
Coding sequences of Glyma18g43530
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g43530.1 sequence type=CDS gene model=Glyma18g43530 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGTCCCGGCGGAATGTTCGTGCAGAGACGCGAAGCGGCGGCTGCGGCGGATAACGGCAGCGCCGCCGGAAACGACAACATGACGACGGTGATGGTCACTGTCGCCCACCATTCTTCCCATCACCACCTGTACCTCCCTACCAACTCCACTTTCTGGGATGTTAAGAGACTGCTTCAACGACTCTTCTTTGGAGGAAAAGAAAAGGACAATGAAGGGCATTTGCATGCAGAAGGTGTGAGGGACATGTCAAAGCTTTTGCTTTTGGAGGATGCTTGTAGAGAAGAGAGGAAACATGAGGAAATTAGAAAACACAATGAAATCACCGACACGGACACTGACACGGACACCGGACACGACATGGACACGGACACGTGGACACCTATAAAAATAACTAAAAATAATGTGGACACGGGTGTCGTGTCGGTATCTGTCTTAGAAGTGGCTGTGGATGGAGGGACCAGGGTTTCTGACAAAGAGTTTTTGATGTCCACAGAGTTGCTTATGAGGCAATTGCTGAAACTGGATGGTATTGAGGCTGAAGGTGGTGAAGTAAAGCTGCAGAGAAAAGCTGAGGTGCATCGTGCGCAGAACTTTGTAGATACACTAGATTCTCTGAAGGCAAAGAACTCCAACCCTTATACTACCATTGGTAAAGCTGTCTCTGTAGCAACCCAATGGGAGACCTTTGACTCTGGAATGGGAAGCTTGAATGCCCCAACCTCAATGACATCTTCTAGAAAT
Predicted protein sequences of Glyma18g43530
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g43530.1 sequence type=predicted peptide gene model=Glyma18g43530 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSPGGMFVQRREAAAAADNGSAAGNDNMTTVMVTVAHHSSHHHLYLPTNSTFWDVKRLLQRLFFGGKEKDNEGHLHAEGVRDMSKLLLLEDACREERKHEEIRKHNEITDTDTDTDTGHDMDTDTWTPIKITKNNVDTGVVSVSVLEVAVDGGTRVSDKEFLMSTELLMRQLLKLDGIEAEGGEVKLQRKAEVHRAQNFVDTLDSLKAKNSNPYTTIGKAVSVATQWETFDSGMGSLNAPTSMTSSRN
SoyBase
SoyBase transitions to NEW site on 10/1/2024
