SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g43381

Feature Type:gene_model
Chromosome:Gm18
Start:52892315
stop:52894490
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g43381
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G40950AT Annotation by Michelle Graham. TAIR10: Basic-leucine zipper (bZIP) transcription factor family protein | chr2:17087823-17090326 REVERSE LENGTH=721 SoyBaseE_val: 6.00E-18ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
UniRef100_A4ZGR1UniRef Annotation by Michelle Graham. Best UniRef hit: Transcription factor bZIP37 (Fragment) n=2 Tax=Glycine max RepID=A4ZGR1_SOYBN SoyBaseE_val: 1.00E-41ISS
UniRef100_A4ZGR1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor bZIP37 (Fragment) n=2 Tax=Glycine max RepID=A4ZGR1_SOYBN SoyBaseE_val: 1.00E-41ISS

Expression Patterns of Glyma18g43381
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g43381 not represented in the dataset
Glyma18g43381 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g43381 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma18g43381
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g43381
>Glyma18g43381.1   sequence type=CDS   gene model=Glyma18g43381   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTAAGTTCTGGCATGTGCACTGAAGTTTTCCAGTTTGATGTTTCTCCATGTACTGGAGCAATAGTTCCTATAACATCAATAGCCAATGTTTCCACTGAAAACCATCAGAATACTACCAGTGTCAAGAAGACCAGGAATAGAAGAACCCTTCATGAGCTCCCAGAGCCGCTTAATGGGGTCTACACGTCTAGTCTAAACATAACTGAAGAACAAGTGAAAAATTTGCAGGAAGACCACCTTCATGTGGTAACAAGTCTTCTATGGTGGTTTCAGTCCTTGTTGATCCCAGAGAGGTTGGTGATGGTGATGTTGATGGCATGA
Predicted protein sequences of Glyma18g43381
>Glyma18g43381.1   sequence type=predicted peptide   gene model=Glyma18g43381   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLSSGMCTEVFQFDVSPCTGAIVPITSIANVSTENHQNTTSVKKTRNRRTLHELPEPLNGVYTSSLNITEEQVKNLQEDHLHVVTSLLWWFQSLLIPERLVMVMLMA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo