Glyma18g43370 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g43370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g43370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g43370

Feature Type:	gene_model
Chromosome:	Gm18
Start:	52858169
stop:	52860269
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g43370

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G51800	AT	Annotation by Michelle Graham. TAIR10: metallopeptidase M24 family protein \| chr3:19211261-19213568 REVERSE LENGTH=385	SoyBase	E_val: 7.00E-39	ISS
GO:0000085	GO-bp	Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle	SoyBase	N/A	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006164	GO-bp	Annotation by Michelle Graham. GO Biological Process: purine nucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0006606	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into nucleus	SoyBase	N/A	ISS
GO:0009220	GO-bp	Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0009640	GO-bp	Annotation by Michelle Graham. GO Biological Process: photomorphogenesis	SoyBase	N/A	ISS
GO:0009987	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004177	GO-mf	Annotation by Michelle Graham. GO Molecular Function: aminopeptidase activity	SoyBase	N/A	ISS
GO:0008235	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metalloexopeptidase activity	SoyBase	N/A	ISS
PTHR10804	Panther	PROTEASE FAMILY M24 (METHIONYL AMINOPEPTIDASE, AMINOPEPTIDASE P)	JGI		ISS
PTHR10804:SF11	Panther	XAA-PRO AMINOPEPTIDASE	JGI		ISS
PF00557	PFAM	Metallopeptidase family M24	JGI		ISS
UniRef100_A0EVX1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: EBP1 n=1 Tax=Ammopiptanthus mongolicus RepID=A0EVX1_9FABA	SoyBase	E_val: 3.00E-53	ISS
UniRef100_UPI000233E6C8	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E6C8 related cluster n=1 Tax=unknown RepID=UPI000233E6C8	SoyBase	E_val: 6.00E-84	ISS

Expression Patterns of Glyma18g43370

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g43370 not represented in the dataset	Glyma18g43370 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g43370 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g43370

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g43370

Limit To All Plant Sequences

>Glyma18g43370.1   sequence type=CDS   gene model=Glyma18g43370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGGACGATGAAAGGGAGGAGAAAGAGTTGGATCTCTCTTCTGCCGAAGTTGTCACCAAATACAAAACCACTGCTGAGATCGTTAACAGTGTTAAGCTTATAATATTCATAAATGAAGGAGCATTGCCTGTTCTTAACATATATCAAACTGGAAATGTGTACAAGAATGTGAAGAGGAAGATTGAGAGATGTGTTGCTTTCCCAACATGTTTATCTGTAAACAGCGTTGTCTGCCATTTCTCTCCAATGGAGTCAGTGGTTTCTGCTATTATTCTGAAGTTGATGTTTGTTTCTTTGGTTGGTTGCAGTGATATGGCATGCCATATAGATGGATTCATCACTGCGGTAGCTCACACCCATGTTCTTCAGGAAGGTCCTGTTGCTGCCACAAATACTGCTGCTGAGGTGGCCTTGAGGCTTGTCAGGCCGGGAAAGAAGGTTTTGATGCTTTCTCTAGAGAGGCAACAACCTTAA

Predicted protein sequences of Glyma18g43370

Limit To All Plant Sequences

>Glyma18g43370.1   sequence type=predicted peptide   gene model=Glyma18g43370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSDDEREEKELDLSSAEVVTKYKTTAEIVNSVKLIIFINEGALPVLNIYQTGNVYKNVKRKIERCVAFPTCLSVNSVVCHFSPMESVVSAIILKLMFVSLVGCSDMACHIDGFITAVAHTHVLQEGPVAATNTAAEVALRLVRPGKKVLMLSLERQQP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain