|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| ATCG00380 | AT | Annotation by Michelle Graham. TAIR10: chloroplast ribosomal protein S4 | chrC:45223-45828 REVERSE LENGTH=201 | SoyBase | E_val: 5.00E-35 | ISS |
| GO:0006091 | GO-bp | Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy | SoyBase | N/A | ISS |
| GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
| GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
| GO:0000312 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastid small ribosomal subunit | SoyBase | N/A | ISS |
| GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
| GO:0015935 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
| GO:0019843 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: rRNA binding | SoyBase | N/A | ISS |
| PTHR11831 | Panther | 30S 40S RIBOSOMAL PROTEIN | JGI | ISS | |
| PTHR11831:SF6 | Panther | JGI | ISS | ||
| PF00163 | PFAM | Ribosomal protein S4/S9 N-terminal domain | JGI | ISS | |
| UniRef100_Q2PMU5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: 30S ribosomal protein S4, chloroplastic n=1 Tax=Glycine max RepID=RR4_SOYBN | SoyBase | E_val: 5.00E-37 | ISS |
| UniRef100_Q2PMU5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein S4, chloroplastic n=1 Tax=Glycine max RepID=RR4_SOYBN | SoyBase | E_val: 5.00E-37 | ISS |
|
Glyma18g43353 not represented in the dataset |
Glyma18g43353 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.18g203700 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g43353.1 sequence type=CDS gene model=Glyma18g43353 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTCACGTTACAGAGGACCTCGTTTCAAGAAAATACGTTGTCTGGGGTCTTTACCAGGACTAACTAGTAAAAGGCCAACAGTCAAAAGCGAACTTAGAAATCAATCGCGCTCCAGTAAAAAATCTCAATATCGTATTGGTTTAGAAGAAAAACAAAAATTGCGTTTTCATTATGGTCTTACAGAACGACAATTGCTTAAATACGTTCGTGAAATTATAATTTTAAAAACGAGAGAAAAAAAATCTTGA
>Glyma18g43353.1 sequence type=predicted peptide gene model=Glyma18g43353 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSRYRGPRFKKIRCLGSLPGLTSKRPTVKSELRNQSRSSKKSQYRIGLEEKQKLRFHYGLTERQLLKYVREIIILKTREKKS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||