SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g43353): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g43353): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g43353

Feature Type:gene_model
Chromosome:Gm18
Start:52855956
stop:52856364
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG00380AT Annotation by Michelle Graham. TAIR10: chloroplast ribosomal protein S4 | chrC:45223-45828 REVERSE LENGTH=201 SoyBaseE_val: 5.00E-35ISS
GO:0006091GO-bp Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0000312GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid small ribosomal subunit SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0015935GO-cc Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
GO:0019843GO-mf Annotation by Michelle Graham. GO Molecular Function: rRNA binding SoyBaseN/AISS
PTHR11831Panther 30S 40S RIBOSOMAL PROTEIN JGI ISS
PTHR11831:SF6Panther JGI ISS
PF00163PFAM Ribosomal protein S4/S9 N-terminal domain JGI ISS
UniRef100_Q2PMU5UniRef Annotation by Michelle Graham. Best UniRef hit: 30S ribosomal protein S4, chloroplastic n=1 Tax=Glycine max RepID=RR4_SOYBN SoyBaseE_val: 5.00E-37ISS
UniRef100_Q2PMU5UniRef Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein S4, chloroplastic n=1 Tax=Glycine max RepID=RR4_SOYBN SoyBaseE_val: 5.00E-37ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g43353 not represented in the dataset

Glyma18g43353 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g203700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g43353.1   sequence type=CDS   gene model=Glyma18g43353   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCACGTTACAGAGGACCTCGTTTCAAGAAAATACGTTGTCTGGGGTCTTTACCAGGACTAACTAGTAAAAGGCCAACAGTCAAAAGCGAACTTAGAAATCAATCGCGCTCCAGTAAAAAATCTCAATATCGTATTGGTTTAGAAGAAAAACAAAAATTGCGTTTTCATTATGGTCTTACAGAACGACAATTGCTTAAATACGTTCGTGAAATTATAATTTTAAAAACGAGAGAAAAAAAATCTTGA

>Glyma18g43353.1   sequence type=predicted peptide   gene model=Glyma18g43353   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSRYRGPRFKKIRCLGSLPGLTSKRPTVKSELRNQSRSSKKSQYRIGLEEKQKLRFHYGLTERQLLKYVREIIILKTREKKS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo