SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g43320

Feature Type:gene_model
Chromosome:Gm18
Start:52755810
stop:52756836
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g43320
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G51810AT Annotation by Michelle Graham. TAIR10: Stress induced protein | chr3:19214818-19215461 FORWARD LENGTH=152 SoyBaseE_val: 4.00E-48ISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0048825GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon development SoyBaseN/AISS
GO:0050826GO-bp Annotation by Michelle Graham. GO Biological Process: response to freezing SoyBaseN/AISS
GO:0051301GO-bp Annotation by Michelle Graham. GO Biological Process: cell division SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF00477PFAM Small hydrophilic plant seed protein JGI ISS
UniRef100_A4VBF1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Late embryogenesis abundant protein n=1 Tax=Vigna radiata RepID=A4VBF1_VIGRA SoyBaseE_val: 3.00E-63ISS
UniRef100_I1N2Z5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N2Z5_SOYBN SoyBaseE_val: 1.00E-69ISS

Expression Patterns of Glyma18g43320
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g43320
ParalogEvidenceComments
Glyma16g19405 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g43320 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g203500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g43320
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g43320
>Glyma18g43320.1   sequence type=CDS   gene model=Glyma18g43320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATCTCAGCAAGCAAACCGTGAAGAACTTGATGAGAAGGCAAGGCAAGGTGAAACTGTTGTTCCTGGAGGAACTGGTGGGAAGAGTCTTGAGGCTCAAGAACATCTTGCTGAAGGAAGGAGCCGTGGAGGGCAGACGAGGAAGCAGCAGCTAGGGTCAGAGGGGTATCATGAAATGGGGACCAAAGGAGGGCAGACAAGGAAGGAACAGATGGGGAGAGAAGGGTACCAAGAGATGGGACGCAAAGGAGGACTCAGCACCATGGACAAGTCTGGTGGAGAACGTGCTGAAGAGGAAGGCATAGAAATAGATGAGTCTAAGTTTAAAATTACCTAA
Predicted protein sequences of Glyma18g43320
>Glyma18g43320.1   sequence type=predicted peptide   gene model=Glyma18g43320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESQQANREELDEKARQGETVVPGGTGGKSLEAQEHLAEGRSRGGQTRKQQLGSEGYHEMGTKGGQTRKEQMGREGYQEMGRKGGLSTMDKSGGERAEEEGIEIDESKFKIT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo