Report for Sequence Feature Glyma18g43170
Feature Type: gene_model
Chromosome: Gm18
Start: 52582315
stop: 52582533
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g43170
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G10265 AT
Annotation by Michelle Graham. TAIR10: Wound-responsive family protein | chr4:6373226-6373477 REVERSE LENGTH=83
SoyBase E_val: 6.00E-23 ISS
GO:0009611 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to wounding
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF12609 PFAM
Wound-induced protein
JGI ISS
UniRef100_I1JMV4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JMV4_SOYBN
SoyBase E_val: 2.00E-36 ISS
UniRef100_Q04129 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Wound induced protein (Fragment) n=1 Tax=Solanum lycopersicum RepID=Q04129_SOLLC
SoyBase E_val: 4.00E-21 ISS
Expression Patterns of Glyma18g43170
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma18g43170 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g202300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g43170
Coding sequences of Glyma18g43170
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g43170.2 sequence type=CDS gene model=Glyma18g43170 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGTACATCAACCAAAGCTTGGATAGTGGCATCAAGAATAGGCGCAGTGGAGGCCTTGAAAGACCAATTAGGTGTATGCAGATGGAACTATGCCTTAAGGTCACTACAACAACATGCAAAGAACAACATCAGATCTTATAGTCAAGCTAGGAAATTGTCCTCTGCATCCTCTGTTGCGGTTTCCAACAGAATACTCAACAAAAGAAAGGAAATGTGA
Predicted protein sequences of Glyma18g43170
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g43170.2 sequence type=predicted peptide gene model=Glyma18g43170 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSTSTKAWIVASRIGAVEALKDQLGVCRWNYALRSLQQHAKNNIRSYSQARKLSSASSVAVSNRILNKRKEM*