Glyma18g43170 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g43170

Feature Type:	gene_model
Chromosome:	Gm18
Start:	52582315
stop:	52582533
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g43170

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G10265	AT	Annotation by Michelle Graham. TAIR10: Wound-responsive family protein \| chr4:6373226-6373477 REVERSE LENGTH=83	SoyBase	E_val: 6.00E-23	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF12609	PFAM	Wound-induced protein	JGI		ISS
UniRef100_I1JMV4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JMV4_SOYBN	SoyBase	E_val: 2.00E-36	ISS
UniRef100_Q04129	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Wound induced protein (Fragment) n=1 Tax=Solanum lycopersicum RepID=Q04129_SOLLC	SoyBase	E_val: 4.00E-21	ISS

Expression Patterns of Glyma18g43170

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g43170 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g202300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g43170

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g43170

Limit To All Plant Sequences

>Glyma18g43170.2   sequence type=CDS   gene model=Glyma18g43170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTACATCAACCAAAGCTTGGATAGTGGCATCAAGAATAGGCGCAGTGGAGGCCTTGAAAGACCAATTAGGTGTATGCAGATGGAACTATGCCTTAAGGTCACTACAACAACATGCAAAGAACAACATCAGATCTTATAGTCAAGCTAGGAAATTGTCCTCTGCATCCTCTGTTGCGGTTTCCAACAGAATACTCAACAAAAGAAAGGAAATGTGA

Predicted protein sequences of Glyma18g43170

Limit To All Plant Sequences

>Glyma18g43170.2   sequence type=predicted peptide   gene model=Glyma18g43170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTSTKAWIVASRIGAVEALKDQLGVCRWNYALRSLQQHAKNNIRSYSQARKLSSASSVAVSNRILNKRKEM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain