SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g43170): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g43170): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g43170

Feature Type:gene_model
Chromosome:Gm18
Start:52582315
stop:52582533
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g43170
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G10265AT Annotation by Michelle Graham. TAIR10: Wound-responsive family protein | chr4:6373226-6373477 REVERSE LENGTH=83 SoyBaseE_val: 6.00E-23ISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF12609PFAM Wound-induced protein JGI ISS
UniRef100_I1JMV4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JMV4_SOYBN SoyBaseE_val: 2.00E-36ISS
UniRef100_Q04129UniRef Annotation by Michelle Graham. Most informative UniRef hit: Wound induced protein (Fragment) n=1 Tax=Solanum lycopersicum RepID=Q04129_SOLLC SoyBaseE_val: 4.00E-21ISS

Expression Patterns of Glyma18g43170
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g43170 not represented in the dataset
Glyma18g43170 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g43170 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g202300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g43170
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g43170
>Glyma18g43170.2   sequence type=CDS   gene model=Glyma18g43170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTACATCAACCAAAGCTTGGATAGTGGCATCAAGAATAGGCGCAGTGGAGGCCTTGAAAGACCAATTAGGTGTATGCAGATGGAACTATGCCTTAAGGTCACTACAACAACATGCAAAGAACAACATCAGATCTTATAGTCAAGCTAGGAAATTGTCCTCTGCATCCTCTGTTGCGGTTTCCAACAGAATACTCAACAAAAGAAAGGAAATGTGA
Predicted protein sequences of Glyma18g43170
>Glyma18g43170.2   sequence type=predicted peptide   gene model=Glyma18g43170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTSTKAWIVASRIGAVEALKDQLGVCRWNYALRSLQQHAKNNIRSYSQARKLSSASSVAVSNRILNKRKEM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo