SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g43165): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g43165): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g43165

Feature Type:gene_model
Chromosome:Gm18
Start:52581639
stop:52582183
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G28110AT Annotation by Michelle Graham. TAIR10: serine carboxypeptidase-like 45 | chr1:9804153-9806832 REVERSE LENGTH=461 SoyBaseE_val: 4.00E-43ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0004185GO-mf Annotation by Michelle Graham. GO Molecular Function: serine-type carboxypeptidase activity SoyBaseN/AISS
PTHR11802Panther SERINE PROTEASE FAMILY S10 SERINE CARBOXYPEPTIDASE JGI ISS
PF00450PFAM Serine carboxypeptidase JGI ISS
UniRef100_B9RA79UniRef Annotation by Michelle Graham. Most informative UniRef hit: Serine carboxypeptidase, putative n=1 Tax=Ricinus communis RepID=B9RA79_RICCO SoyBaseE_val: 3.00E-44ISS
UniRef100_I1KP34UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KP34_SOYBN SoyBaseE_val: 1.00E-52ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g43165 not represented in the dataset

Glyma18g43165 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g202200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g43165.1   sequence type=CDS   gene model=Glyma18g43165   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCTCTTTTACTATTTTGTTGAATCAAAAACGGATCCAGCTTCAAAGCCTCTTGTTCTTTGGCTCAATGGAGGACCAGGTTGTTCTTCTCTTGGAGTGGGTGCATTCTCTGAAAATGGACCTTTTAGACCAAATGGAGAAGTTCTGATTAAAAATGAGTACAGTTGGAACAAAGAAACAAACATGTTGTATTTAGAGACACCAGTTGGAGAAGGGTTCTCTTATGCTAAAGGTGGCTCCTCCTATGACTTTGCGAATGATGAGACAACACGTAATCTATGA

>Glyma18g43165.1   sequence type=predicted peptide   gene model=Glyma18g43165   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALFYYFVESKTDPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEVLIKNEYSWNKETNMLYLETPVGEGFSYAKGGSSYDFANDETTRNL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo