Glyma18g42910 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g42910

Feature Type:	gene_model
Chromosome:	Gm18
Start:	52197079
stop:	52200967
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g42910

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G08980	AT	Annotation by Michelle Graham. TAIR10: Peptidase S24/S26A/S26B/S26C family protein \| chr3:2741279-2742375 FORWARD LENGTH=154	SoyBase	E_val: 4.00E-63	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0010267	GO-bp	Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference	SoyBase	N/A	ISS
GO:0035196	GO-bp	Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA	SoyBase	N/A	ISS
GO:0051607	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to virus	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0008233	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peptidase activity	SoyBase	N/A	ISS
GO:0008236	GO-mf	Annotation by Michelle Graham. GO Molecular Function: serine-type peptidase activity	SoyBase	N/A	ISS
KOG1568	KOG	Mitochondrial inner membrane protease, subunit IMP2	JGI		ISS
PTHR12383	Panther	PROTEASE FAMILY S26 MITOCHONDRIAL INNER MEMBRANE PROTEASE-RELATED	JGI		ISS
PTHR12383:SF8	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00717	PFAM	Peptidase S24-like	JGI		ISS
UniRef100_C6T4A9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T4A9_SOYBN	SoyBase	E_val: 2.00E-120	ISS
UniRef100_G7K6I3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial inner membrane protease subunit n=1 Tax=Medicago truncatula RepID=G7K6I3_MEDTR	SoyBase	E_val: 2.00E-79	ISS

Expression Patterns of Glyma18g42910

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g42910

Paralog	Evidence	Comments
Glyma07g18060	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g42910 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g200000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g42910

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g42910

Limit To All Plant Sequences

>Glyma18g42910.1   sequence type=CDS   gene model=Glyma18g42910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGACAAGCAGTTTTCTATGGAACTGTACTAAAAAATTCATCACAGCCGGGATCGTCACTGTGACTGTGACTGATCATTTTGTGACAGTTATTCCAGTTCGAGGCGGATCTATGTCTCCCACATTTAATCCTAAAGCTGGTTCTCATATGGGAGATGTTTTTGATGACTATGTTTTGGTTGAGAAATTTTGCCTTAGGAATTACAAGTTTTCACATGGCGATGTGGTGGTCTTTCGCTCCCCTCTAAATCACAAGGAGACACACGTAAAGAGAATAGCTGCATTACCTGGTGAATGGTTTGGCACTCATCATAACAATGATGTGATTCAGATTCCATTAGGACATTGTTGGGTTGAAGGAGACAACACCGCTTCTAGCTTGGATTCAAATTCATTTGGACCAATTCCTTTGGCCCTAATTCGGGGAAGGGTTACCCATGTTGTGTGGCCTCCTCAAAGAATAGGAGCTGTCAAGAGTACTCCACCGCAACGATTATCTTCTTTTTAG

Predicted protein sequences of Glyma18g42910

Limit To All Plant Sequences

>Glyma18g42910.1   sequence type=predicted peptide   gene model=Glyma18g42910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGTSSFLWNCTKKFITAGIVTVTVTDHFVTVIPVRGGSMSPTFNPKAGSHMGDVFDDYVLVEKFCLRNYKFSHGDVVVFRSPLNHKETHVKRIAALPGEWFGTHHNNDVIQIPLGHCWVEGDNTASSLDSNSFGPIPLALIRGRVTHVVWPPQRIGAVKSTPPQRLSSF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain