SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g42751

Feature Type:gene_model
Chromosome:Gm18
Start:52046303
stop:52047011
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G08850AT Annotation by Michelle Graham. TAIR10: Leucine-rich repeat receptor-like protein kinase family protein | chr4:5636693-5640496 REVERSE LENGTH=1045 SoyBaseE_val: 3.00E-43ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006857GO-bp Annotation by Michelle Graham. GO Biological Process: oligopeptide transport SoyBaseN/AISS
GO:0006995GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to nitrogen starvation SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF472Panther SUBFAMILY NOT NAMED JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_C6ZRZ7UniRef Annotation by Michelle Graham. Best UniRef hit: Leucine-rich repeat family protein / protein kinase family protein n=1 Tax=Glycine max RepID=C6ZRZ7_SOYBN SoyBaseE_val: 1.00E-95ISS
UniRef100_C6ZRZ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Leucine-rich repeat family protein / protein kinase family protein n=1 Tax=Glycine max RepID=C6ZRZ7_SOYBN SoyBaseE_val: 1.00E-95ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g42751 not represented in the dataset

Glyma18g42751 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g199100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g42751.1   sequence type=CDS   gene model=Glyma18g42751   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTGTTCACCTCCAATTGTTTCATCGAGATATATCAAGCAAGAATGTTATTATGGATTTGGAGTATGTGGCTCATGTCTCAGATTTTGGAACAGCCAAGCTTCTTAATCCTAATTCAACCAATTGGACCTCATTTGTTGGCACTTTTGGATATGCTGCTCCAGAACTTGCATACACAATGGAAGTGAACCAAAAATGCGATGTGTATAGCTTTGGGGTATTAGCATTGGAAATACTTCTTGGAGAGCACCCTGGAGATTTTATAACTTCGTTGTTGACATGTTCATCAAATGCCATGGCGTCAACACTTGATATTCCTTCATTGATGGGTAAGTTAGACCAACGTCTCCCTTATCCTACAAATCAAATGGCTAAGGAGATAGCTTTGATTGCAAAGACAACAATTGCTTGCTTGACTGAAAGCCCTCATTCTCGTCTCACCATGGAGCAAGTTGCCAAGGAGCTTGGAATGTCAAAGTCATCTTCAGTGCATTAA

>Glyma18g42751.1   sequence type=predicted peptide   gene model=Glyma18g42751   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTVHLQLFHRDISSKNVIMDLEYVAHVSDFGTAKLLNPNSTNWTSFVGTFGYAAPELAYTMEVNQKCDVYSFGVLALEILLGEHPGDFITSLLTCSSNAMASTLDIPSLMGKLDQRLPYPTNQMAKEIALIAKTTIACLTESPHSRLTMEQVAKELGMSKSSSVH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo