Glyma18g42715 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g42715): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g42715): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g42715

Feature Type:	gene_model
Chromosome:	Gm18
Start:	51990124
stop:	51990415
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g42715

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G35720	AT	Annotation by Michelle Graham. TAIR10: DNAJ heat shock N-terminal domain-containing protein \| chr2:15016883-15019866 FORWARD LENGTH=538	SoyBase	E_val: 4.00E-19	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0010228	GO-bp	Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem	SoyBase	N/A	ISS
GO:0055122	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to very low light intensity stimulus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0031072	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding	SoyBase	N/A	ISS
PF00226	PFAM	DnaJ domain	JGI		ISS
UniRef100_B6T7S1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Chaperone protein dnaJ 13 n=1 Tax=Zea mays RepID=B6T7S1_MAIZE	SoyBase	E_val: 4.00E-18	ISS
UniRef100_I1J9W4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J9W4_SOYBN	SoyBase	E_val: 2.00E-23	ISS

Expression Patterns of Glyma18g42715

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g42715 not represented in the dataset	Glyma18g42715 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g42715 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g198900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g42715

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g42715

Limit To All Plant Sequences

>Glyma18g42715.1   sequence type=CDS   gene model=Glyma18g42715   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGATATTGCTACGGAGAACTTTCAGCAAATATACAAAGCATATGAGATTCTTTCAGATCTGAATAAAAGGCAAATATATGATATCTACAGCATGGAGGGATTGACCTCTGGTTTGGAACTTGGTCCAAAGCATAATGGAGTTGAAGAGATCAAGGCAGAGCTCAGAGGGTATTGCTCCGTTCATCATAGTTTTTGCTTATTTATATCAATACAATATGAATGA

Predicted protein sequences of Glyma18g42715

Limit To All Plant Sequences

>Glyma18g42715.1   sequence type=predicted peptide   gene model=Glyma18g42715   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKDIATENFQQIYKAYEILSDLNKRQIYDIYSMEGLTSGLELGPKHNGVEEIKAELRGYCSVHHSFCLFISIQYE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain