SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g42450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g42450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g42450

Feature Type:gene_model
Chromosome:Gm18
Start:51532230
stop:51533093
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g42450
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G12620AT Annotation by Michelle Graham. TAIR10: Protein phosphatase 2C family protein | chr3:4009510-4010993 REVERSE LENGTH=385 SoyBaseE_val: 4.00E-31ISS
GO:0006470GO-bp Annotation by Michelle Graham. GO Biological Process: protein dephosphorylation SoyBaseN/AISS
GO:0008287GO-cc Annotation by Michelle Graham. GO Cellular Compartment: protein serine/threonine phosphatase complex SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004722GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine phosphatase activity SoyBaseN/AISS
PTHR13832Panther PROTEIN PHOSPHATASE 2C JGI ISS
PTHR13832:SF97Panther PROTEIN PHOSPHATASE-2C JGI ISS
PF00481PFAM Protein phosphatase 2C JGI ISS
UniRef100_Q9LHJ9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Probable protein phosphatase 2C 38 n=1 Tax=Arabidopsis thaliana RepID=P2C38_ARATH SoyBaseE_val: 2.00E-28ISS
UniRef100_UPI000233E553UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E553 related cluster n=1 Tax=unknown RepID=UPI000233E553 SoyBaseE_val: 3.00E-62ISS

Expression Patterns of Glyma18g42450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g42450 not represented in the dataset
Glyma18g42450 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g42450 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g196900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g42450
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g42450
>Glyma18g42450.1   sequence type=CDS   gene model=Glyma18g42450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACATGATCAAGGTTGTCAGACTCGTGATTCTATGTAGAATCGTGGAGATTTCAAGATCCATTGGTGATGCCTATCTAAAGAAGGCAGAGTTTAATAAAGCACCATTATTAGCAAAATTTCGACTCTCAGAACCCTTTGATCAACCAATCCTTAAAGCTGAACCAGCTATACTAGTACAGAAATTGTGTCCTCAAGAGCTGTTTCTTATACTTGCATCAGATGGATTATGGGAGCAAATGAGCAATCAAGAAGCAGTTAACATTAATTGGAATGAAACATTTTATAAAATTCTATTGAACACATGCTGCGAAGAAAAAAGAAACCAACACATAGATCGTAGTTCCCTTGTGATCCCTGAAGGCCTACACGGAAATACATGGTTTGACCTGCAATGCCCCAAAACAAATCATTATTAG
Predicted protein sequences of Glyma18g42450
>Glyma18g42450.1   sequence type=predicted peptide   gene model=Glyma18g42450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHMIKVVRLVILCRIVEISRSIGDAYLKKAEFNKAPLLAKFRLSEPFDQPILKAEPAILVQKLCPQELFLILASDGLWEQMSNQEAVNINWNETFYKILLNTCCEEKRNQHIDRSSLVIPEGLHGNTWFDLQCPKTNHY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo