Report for Sequence Feature Glyma18g42450
Feature Type: gene_model
Chromosome: Gm18
Start: 51532230
stop: 51533093
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g42450
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G12620 AT
Annotation by Michelle Graham. TAIR10: Protein phosphatase 2C family protein | chr3:4009510-4010993 REVERSE LENGTH=385
SoyBase E_val: 4.00E-31 ISS
GO:0006470 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein dephosphorylation
SoyBase N/A ISS
GO:0008287 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: protein serine/threonine phosphatase complex
SoyBase N/A ISS
GO:0003824 GO-mf
Annotation by Michelle Graham. GO Molecular Function: catalytic activity
SoyBase N/A ISS
GO:0004722 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine phosphatase activity
SoyBase N/A ISS
PTHR13832 Panther
PROTEIN PHOSPHATASE 2C
JGI ISS
PTHR13832:SF97 Panther
PROTEIN PHOSPHATASE-2C
JGI ISS
PF00481 PFAM
Protein phosphatase 2C
JGI ISS
UniRef100_Q9LHJ9 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Probable protein phosphatase 2C 38 n=1 Tax=Arabidopsis thaliana RepID=P2C38_ARATH
SoyBase E_val: 2.00E-28 ISS
UniRef100_UPI000233E553 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233E553 related cluster n=1 Tax=unknown RepID=UPI000233E553
SoyBase E_val: 3.00E-62 ISS
Expression Patterns of Glyma18g42450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma18g42450 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g196900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g42450
Coding sequences of Glyma18g42450
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g42450.1 sequence type=CDS gene model=Glyma18g42450 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCACATGATCAAGGTTGTCAGACTCGTGATTCTATGTAGAATCGTGGAGATTTCAAGATCCATTGGTGATGCCTATCTAAAGAAGGCAGAGTTTAATAAAGCACCATTATTAGCAAAATTTCGACTCTCAGAACCCTTTGATCAACCAATCCTTAAAGCTGAACCAGCTATACTAGTACAGAAATTGTGTCCTCAAGAGCTGTTTCTTATACTTGCATCAGATGGATTATGGGAGCAAATGAGCAATCAAGAAGCAGTTAACATTAATTGGAATGAAACATTTTATAAAATTCTATTGAACACATGCTGCGAAGAAAAAAGAAACCAACACATAGATCGTAGTTCCCTTGTGATCCCTGAAGGCCTACACGGAAATACATGGTTTGACCTGCAATGCCCCAAAACAAATCATTATTAG
Predicted protein sequences of Glyma18g42450
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g42450.1 sequence type=predicted peptide gene model=Glyma18g42450 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MHMIKVVRLVILCRIVEISRSIGDAYLKKAEFNKAPLLAKFRLSEPFDQPILKAEPAILVQKLCPQELFLILASDGLWEQMSNQEAVNINWNETFYKILLNTCCEEKRNQHIDRSSLVIPEGLHGNTWFDLQCPKTNHY*