SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g42111

Feature Type:gene_model
Chromosome:Gm18
Start:51025788
stop:51026423
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G13870AT Annotation by Michelle Graham. TAIR10: Werner syndrome-like exonuclease | chr4:8023563-8025542 REVERSE LENGTH=285 SoyBaseE_val: 1.00E-18ISS
GO:0006139GO-bp Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008408GO-mf Annotation by Michelle Graham. GO Molecular Function: 3'-5' exonuclease activity SoyBaseN/AISS
PTHR13620Panther 3-5 EXONUCLEASE JGI ISS
PF01612PFAM 3'-5' exonuclease JGI ISS
UniRef100_E5GBP0UniRef Annotation by Michelle Graham. Most informative UniRef hit: 3'-5' exonuclease n=1 Tax=Cucumis melo subsp. melo RepID=E5GBP0_CUCME SoyBaseE_val: 2.00E-53ISS
UniRef100_I1N2S4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1N2S4_SOYBN SoyBaseE_val: 3.00E-98ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g42111 not represented in the dataset

Glyma18g42111 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g194500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g42111.1   sequence type=CDS   gene model=Glyma18g42111   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGACGATAACACTAATAGGAGAAAACAGCACCGAAACCCACAACTACAAGCTCTACGAAGTCACCGTCGAAGACACCGACACCATCCAAACCCTCCTCACTTCTTCCCCCTCCCAAGTCAGCTCATGGCTCTCCACCAACACCACCCGCTACCATCCGGGCCTCATCGTGGGCCTCATCGCGCAGTGGCGGCCCAACACCCTGCCCAACATGAACAACCCCGTGGCCACCCTCCACCTCTGCGTGGACCACCGCTGCCTCATCTTCCAGATCCTCCACGCGCCCTCCGTCCCACGCGCCCTCATCTCCTTCCTCGCCAGCCCCAACGTCACATTCGTCGGGGTCGGCATCCATGGTCACGTGGACAAGCTTTTTCAAGACTACAATCTCCGCGTGGCCAATGTTCGCGACCTTCGCTCCCTTGCCGCGGAGGAGCTCAACGTGCCTGAGCTGTATTGGGCCGGGCTCGACACGTTGGGTCTGTGCACCCTGGGCTTTGAGGTTAGCACGCCCCGCTATATCACCACGAGTCGTTGGGATAATCGCTCCCTCACTGAGGAGCAGGTTGAGTATGCTGCTGTTGATGCCTTTGTCTCCTGTGGGGTTGGTCGCACTTTGACTTCTGATAACTAA

>Glyma18g42111.1   sequence type=predicted peptide   gene model=Glyma18g42111   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTITLIGENSTETHNYKLYEVTVEDTDTIQTLLTSSPSQVSSWLSTNTTRYHPGLIVGLIAQWRPNTLPNMNNPVATLHLCVDHRCLIFQILHAPSVPRALISFLASPNVTFVGVGIHGHVDKLFQDYNLRVANVRDLRSLAAEELNVPELYWAGLDTLGLCTLGFEVSTPRYITTSRWDNRSLTEEQVEYAAVDAFVSCGVGRTLTSDN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo