|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G11710 | AT | Annotation by Michelle Graham. TAIR10: ENTH/VHS family protein | chr5:3772981-3776316 FORWARD LENGTH=560 | SoyBase | E_val: 1.00E-53 | ISS |
GO:0006623 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole | SoyBase | N/A | ISS |
GO:0006886 | GO-bp | Annotation by Michelle Graham. GO Biological Process: intracellular protein transport | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
GO:0005884 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: actin filament | SoyBase | N/A | ISS |
GO:0009579 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: thylakoid | SoyBase | N/A | ISS |
GO:0002020 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protease binding | SoyBase | N/A | ISS |
GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
GO:0030276 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: clathrin binding | SoyBase | N/A | ISS |
PTHR12276 | Panther | EPSIN/ENT-RELATED | JGI | ISS | |
PTHR12276:SF7 | Panther | EPSIN 2 | JGI | ISS | |
PF01417 | PFAM | ENTH domain | JGI | ISS | |
UniRef100_I1MXE8 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MXE8_SOYBN | SoyBase | E_val: 2.00E-58 | ISS |
UniRef100_Q8VY07 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Clathrin interactor EPSIN 1 n=1 Tax=Arabidopsis thaliana RepID=EPN1_ARATH | SoyBase | E_val: 5.00E-51 | ISS |
Glyma18g41846 not represented in the dataset |
Glyma18g41846 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.18g193000 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g41846.1 sequence type=CDS gene model=Glyma18g41846 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAGACTGTCTCCGGCCGTCAAAGTGAGCTCGCGTCGTTAGCACTGTGTCCCTCCACAAAGAGAGAGGTGAATCTGAAGGTGCTCAAGGTTCCAGAAATCGAACCGAAGGTGCTGGATGCTACTGATAATGAACCTTGGGGTCCTCATGGTACTGTGCTGGCAGAGATTTCACAGGCTACCGAAAAATTTACTAAATGTCAAATGGTCATGAATGTCCTTTGGACAAGACTGGGTGAAACTGGAAAAGATTGGCGTTATGTATACAAGGCATTAGCTGTCATAGAATATTTGGTAGCACATGGATCTGAACGTGCAATTGATGACATTATAGAACATACTTTTTAG
>Glyma18g41846.1 sequence type=predicted peptide gene model=Glyma18g41846 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKTVSGRQSELASLALCPSTKREVNLKVLKVPEIEPKVLDATDNEPWGPHGTVLAEISQATEKFTKCQMVMNVLWTRLGETGKDWRYVYKALAVIEYLVAHGSERAIDDIIEHTF*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||