Glyma18g41811 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g41811): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g41811): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g41811

Feature Type:	gene_model
Chromosome:	Gm18
Start:	50736470
stop:	50737038
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g41811

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G13950	AT	Annotation by Michelle Graham. TAIR10: eukaryotic elongation factor 5A-1 \| chr1:4773631-4774668 FORWARD LENGTH=158	SoyBase	E_val: 6.00E-37	ISS
GO:0006413	GO-bp	Annotation by Michelle Graham. GO Biological Process: translational initiation	SoyBase	N/A	ISS
GO:0006452	GO-bp	Annotation by Michelle Graham. GO Biological Process: translational frameshifting	SoyBase	N/A	ISS
GO:0008612	GO-bp	Annotation by Michelle Graham. GO Biological Process: peptidyl-lysine modification to hypusine	SoyBase	N/A	ISS
GO:0010089	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylem development	SoyBase	N/A	ISS
GO:0045901	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of translational elongation	SoyBase	N/A	ISS
GO:0045905	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of translational termination	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0003743	GO-mf	Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity	SoyBase	N/A	ISS
GO:0003746	GO-mf	Annotation by Michelle Graham. GO Molecular Function: translation elongation factor activity	SoyBase	N/A	ISS
GO:0043022	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ribosome binding	SoyBase	N/A	ISS
PTHR11673	Panther	TRANSLATION INITIATION FACTOR 5A-RELATED	JGI		ISS
UniRef100_C6ZHS4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Eukaryotic translation initiation factor 5A2 n=1 Tax=Glycine max RepID=C6ZHS4_SOYBN	SoyBase	E_val: 2.00E-39	ISS
UniRef100_UPI000233F119	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233F119 related cluster n=1 Tax=unknown RepID=UPI000233F119	SoyBase	E_val: 2.00E-47	ISS

Expression Patterns of Glyma18g41811

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g41811 not represented in the dataset	Glyma18g41811 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g41811 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g192700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g41811

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g41811

Limit To All Plant Sequences

>Glyma18g41811.1   sequence type=CDS   gene model=Glyma18g41811   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGGACGAAGAGCACCATTTCGAGTCCAAGGCCGACGCCAGTGACTCTAAAACCTACCCTCAACAAGCAAGTACCATTCACAAGAATGACTACATCGTCATCAAAGGCCGCCCCTACAAGCACGATCACGCTAAGTGCCATTTTGTTGGAATTGATATTTTCACTACCAAGAAACTTGAGGATATTGTGCCCTCTTCTCACAACTGTGATGTCCCTCATGTGAATCCTATTGATTAA

Predicted protein sequences of Glyma18g41811

Limit To All Plant Sequences

>Glyma18g41811.1   sequence type=predicted peptide   gene model=Glyma18g41811   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSDEEHHFESKADASDSKTYPQQASTIHKNDYIVIKGRPYKHDHAKCHFVGIDIFTTKKLEDIVPSSHNCDVPHVNPID*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain