SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g41800

Feature Type:gene_model
Chromosome:Gm18
Start:50730944
stop:50731380
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g41800
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G69410AT Annotation by Michelle Graham. TAIR10: eukaryotic elongation factor 5A-3 | chr1:26089301-26090194 FORWARD LENGTH=158 SoyBaseE_val: 2.00E-35ISS
GO:0006413GO-bp Annotation by Michelle Graham. GO Biological Process: translational initiation SoyBaseN/AISS
GO:0006452GO-bp Annotation by Michelle Graham. GO Biological Process: translational frameshifting SoyBaseN/AISS
GO:0008612GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-lysine modification to hypusine SoyBaseN/AISS
GO:0045901GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of translational elongation SoyBaseN/AISS
GO:0045905GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of translational termination SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003743GO-mf Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity SoyBaseN/AISS
GO:0003746GO-mf Annotation by Michelle Graham. GO Molecular Function: translation elongation factor activity SoyBaseN/AISS
GO:0043022GO-mf Annotation by Michelle Graham. GO Molecular Function: ribosome binding SoyBaseN/AISS
PTHR11673Panther TRANSLATION INITIATION FACTOR 5A-RELATED JGI ISS
PF01287PFAM Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold JGI ISS
UniRef100_C6ZHS4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Eukaryotic translation initiation factor 5A2 n=1 Tax=Glycine max RepID=C6ZHS4_SOYBN SoyBaseE_val: 1.00E-38ISS
UniRef100_UPI000233F119UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F119 related cluster n=1 Tax=unknown RepID=UPI000233F119 SoyBaseE_val: 9.00E-45ISS

Expression Patterns of Glyma18g41800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g41800 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g192600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g41800
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g41800
>Glyma18g41800.1   sequence type=CDS   gene model=Glyma18g41800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACACACCACAATTACCAGCTCATTGATATTGCTGAGGATGGATTTTTGAGTCTGCTTACTAAAAATGGGAACACCAAGGATGACCTCAAGCTTCCCACTGATGAGAGTCTGCTCACTCAGATAAAGGATGGGTTTGTTGAGGGCAAGGATCTTGTTGTGTCTGTCATGTCTGCTATTGGTGAGGAACAAACTTGCGCTCTGAAGGATATTGGGCCTAAGAACTAG
Predicted protein sequences of Glyma18g41800
>Glyma18g41800.1   sequence type=predicted peptide   gene model=Glyma18g41800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
THHNYQLIDIAEDGFLSLLTKNGNTKDDLKLPTDESLLTQIKDGFVEGKDLVVSVMSAIGEEQTCALKDIGPKN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo