SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g41730): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g41730): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g41730

Feature Type:gene_model
Chromosome:Gm18
Start:50712410
stop:50713337
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G39740AT Annotation by Michelle Graham. TAIR10: ribosomal protein L5 B | chr5:15903484-15905185 FORWARD LENGTH=301 SoyBaseE_val: 3.00E-56ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
GO:0008097GO-mf Annotation by Michelle Graham. GO Molecular Function: 5S rRNA binding SoyBaseN/AISS
PTHR23410Panther RIBOSOMAL PROTEIN L5-RELATED JGI ISS
PF00861PFAM Ribosomal L18p/L5e family JGI ISS
UniRef100_G7J8J8UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L5 n=1 Tax=Medicago truncatula RepID=G7J8J8_MEDTR SoyBaseE_val: 1.00E-60ISS
UniRef100_UPI000233E3F7UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E3F7 related cluster n=1 Tax=unknown RepID=UPI000233E3F7 SoyBaseE_val: 1.00E-71ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g41730 not represented in the dataset

Glyma18g41730 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g41730.1   sequence type=CDS   gene model=Glyma18g41730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TACTGGAGAGGATTATCCGTGGAACCTGCTGAGAGCAAGAGGCCATTCCGTGCTCTCCTTGACGTTGGTCTTATTAAGACTACAACCGGTAACCGCGTGTTTGGTGCCCTTAAGGGAGCTCTGGATGGGGGTTTGGATATTCCTCACAATGACAAGAGGTTTGCTGGGTTTGATAAGGAGAAGAAGGAGCTTGATGTAGAGGTTCATCGCAAATATGTTTTTGGTGGACATAAGATGAACCAGAGAAATACCAGTCACACTTCAGTGAATACATCAAGCGTTCATGCTGCCATCCGGGCTGATCCTACTCTCAAGAAATCTGATAAGCAGCCCCCAAAGGAGCACAAGAGGAGAATGTTCTTGAGAGTATCTGCCTCTTTCTGCAAGTACAACTTGAAGAAGCTGACCTATGAGGACAGGAAGGCTAAGTTCATTTCACGCGTGGCGGCTCTCAACTCTAGATGTTGCCGATAA

>Glyma18g41730.1   sequence type=predicted peptide   gene model=Glyma18g41730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YWRGLSVEPAESKRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHNDKRFAGFDKEKKELDVEVHRKYVFGGHKMNQRNTSHTSVNTSSVHAAIRADPTLKKSDKQPPKEHKRRMFLRVSASFCKYNLKKLTYEDRKAKFISRVAALNSRCCR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo