Glyma18g41350 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g41350

Feature Type:	gene_model
Chromosome:	Gm18
Start:	50205415
stop:	50207308
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g41350

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G29420	AT	Annotation by Michelle Graham. TAIR10: glutathione S-transferase tau 7 \| chr2:12618111-12618871 REVERSE LENGTH=227	SoyBase	E_val: 4.00E-73	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0009751	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus	SoyBase	N/A	ISS
GO:0010583	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0004364	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glutathione transferase activity	SoyBase	N/A	ISS
KOG0406	KOG	Glutathione S-transferase	JGI		ISS
PTHR11260	Panther	GLUTATHIONE S-TRANSFERASE, GST, SUPERFAMILY, GST DOMAIN CONTAINING	JGI		ISS
PTHR11260:SF16	Panther	GLUTATHIONE S-TRANSFERASE THETA	JGI		ISS
PF00043	PFAM	Glutathione S-transferase, C-terminal domain	JGI		ISS
PF02798	PFAM	Glutathione S-transferase, N-terminal domain	JGI		ISS
UniRef100_Q9FQE7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Glutathione S-transferase GST 11 n=1 Tax=Glycine max RepID=Q9FQE7_SOYBN	SoyBase	E_val: 7.00E-160	ISS
UniRef100_Q9FQE7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Glutathione S-transferase GST 11 n=1 Tax=Glycine max RepID=Q9FQE7_SOYBN	SoyBase	E_val: 7.00E-160	ISS

Expression Patterns of Glyma18g41350

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g41350

Paralog	Evidence	Comments
Glyma07g16860	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g41350 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g190300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g41350

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g41350

Limit To All Plant Sequences

>Glyma18g41350.1   sequence type=CDS   gene model=Glyma18g41350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCAAGTCAGGAAGAGGTGACCCTTTTGGGAGTTGTGGGAAGCCCATTTCTACACAGGGTTCAGATTGCTCTCAAGTTGAAGGGAGTTGAATACAAATATTTGGAAGACGATTTGAACAACAAGAGTGATTTGCTCCTCAAGTATAACCCAGTTTACAAAATGATTCCAGTGCTTGTTCACAATGAGAAGCCCATTTCAGAGTCCCTTGTGATTGTTGAGTACATTGATGACACATGGAAAAACAATCCCATCTTGCCTTCTGATCCCTACCAAAGAGCCTTGGCTCGTTTCTGGGCTAAGTTCATTGATGACAAGTGTGTGGTTCCAGCATGGAAATCTGCTTTTATGACTGATGAGAAAGAGAAAGAGAAGGCTAAAGAAGAGTTATTTGAGGCTCTGAGTTTTCTTGAGAATGAGTTGAAGGGCAAGTTTTTTGGTGGAGAGGAGTTTGGCTTTGTGGATATTGCTGCTGTGTTAATACCTATAATTCAAGAGATAGCAGGGTTGCAATTGTTCACAAGTGAGAAATTCCCAAAGCTCTCTAAATGGAGCCAAGACTTTCACAACCATCCAGTTGTCAACGAAGTTATGCCTCCTAAGGATCAACTTTTTGCCTATTTCAAGGCTCGGGCTCAAAGCTTCGTTGCTAAAAGAAAGAATTAA

Predicted protein sequences of Glyma18g41350

Limit To All Plant Sequences

>Glyma18g41350.1   sequence type=predicted peptide   gene model=Glyma18g41350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSQEEVTLLGVVGSPFLHRVQIALKLKGVEYKYLEDDLNNKSDLLLKYNPVYKMIPVLVHNEKPISESLVIVEYIDDTWKNNPILPSDPYQRALARFWAKFIDDKCVVPAWKSAFMTDEKEKEKAKEELFEALSFLENELKGKFFGGEEFGFVDIAAVLIPIIQEIAGLQLFTSEKFPKLSKWSQDFHNHPVVNEVMPPKDQLFAYFKARAQSFVAKRKN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain