Glyma18g41320 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g41320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g41320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g41320

Feature Type:	gene_model
Chromosome:	Gm18
Start:	50159943
stop:	50161514
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g41320

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G53980	AT	Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein \| chr3:19987760-19988203 REVERSE LENGTH=114	SoyBase	E_val: 2.00E-44	ISS
GO:0006869	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid transport	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0008289	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lipid binding	SoyBase	N/A	ISS
PF00234	PFAM	Protease inhibitor/seed storage/LTP family	JGI		ISS
UniRef100_C6SVZ6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVZ6_SOYBN	SoyBase	E_val: 1.00E-79	ISS
UniRef100_G7L5L7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protease inhibitor/seed storage/LTP family protein n=1 Tax=Medicago truncatula RepID=G7L5L7_MEDTR	SoyBase	E_val: 1.00E-64	ISS

Expression Patterns of Glyma18g41320

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g41320 not represented in the dataset	Glyma18g41320 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g41320

Paralog	Evidence	Comments
Glyma07g16770	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g41320 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g190000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g41320

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g41320

Limit To All Plant Sequences

>Glyma18g41320.1   sequence type=CDS   gene model=Glyma18g41320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGTTGTACTTATTGTGTGAAGTTGCTATGCCTTGTTGGGTTTGTGGTGCTTGTGAGTACTATTGCAGGGGTGGAGAGTGCTGGTGAATGTGGGAAATCTACCACCCCAGATAATGAGGCTTATAAGCTTGCACCATGTGCCTCAGCAGCACAAGATGAGAATGCTAGTGTTTCTCAGAGTTGCTGTGCTCAGGTGAAGAAAATTGGGCAGAACCCAAGCTGCCTCTGTGCAGTTCTGCTCTCCAACACAGCCAAAATGGCTGGTGTCAACCCTCAAGTTGCTGTCACCATCCCCAAGCGTTGCAACCTGGCTAATCGCCCTGTTGGTTACAAGTGTGGACCTTACACTCTGCCTTGA

Predicted protein sequences of Glyma18g41320

Limit To All Plant Sequences

>Glyma18g41320.1   sequence type=predicted peptide   gene model=Glyma18g41320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGCTYCVKLLCLVGFVVLVSTIAGVESAGECGKSTTPDNEAYKLAPCASAAQDENASVSQSCCAQVKKIGQNPSCLCAVLLSNTAKMAGVNPQVAVTIPKRCNLANRPVGYKCGPYTLP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain