SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g41185

Feature Type:gene_model
Chromosome:Gm18
Start:49916985
stop:49918210
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g41185
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G10130AT Annotation by Michelle Graham. TAIR10: endoplasmic reticulum-type calcium-transporting ATPase 3 | chr1:3311139-3321941 FORWARD LENGTH=998 SoyBaseE_val: 3.00E-27ISS
GO:0006754GO-bp Annotation by Michelle Graham. GO Biological Process: ATP biosynthetic process SoyBaseN/AISS
GO:0006812GO-bp Annotation by Michelle Graham. GO Biological Process: cation transport SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0006828GO-bp Annotation by Michelle Graham. GO Biological Process: manganese ion transport SoyBaseN/AISS
GO:0006891GO-bp Annotation by Michelle Graham. GO Biological Process: intra-Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0055071GO-bp Annotation by Michelle Graham. GO Biological Process: manganese ion homeostasis SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005802GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network SoyBaseN/AISS
GO:0012505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endomembrane system SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0005388GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium-transporting ATPase activity SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0015410GO-mf Annotation by Michelle Graham. GO Molecular Function: manganese-transporting ATPase activity SoyBaseN/AISS
GO:0015662GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
PTHR24093Panther FAMILY NOT NAMED JGI ISS
PTHR24093:SF92Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_B9R6Y5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cation-transporting atpase, putative n=1 Tax=Ricinus communis RepID=B9R6Y5_RICCO SoyBaseE_val: 1.00E-24ISS
UniRef100_I1JTR9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JTR9_SOYBN SoyBaseE_val: 1.00E-28ISS

Expression Patterns of Glyma18g41185
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g41185 not represented in the dataset
Glyma18g41185 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g41185 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g189000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g41185
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g41185
>Glyma18g41185.1   sequence type=CDS   gene model=Glyma18g41185   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTTTGAAGCAATTTGATGATTTGCTTGTAAAGATACTAATTGTAGCTGCTCTTATATCTTTTATTCTGGCATTAATTAATGGAGAAACAGGCTTGATGGCATTTTTGGAGCCTTCTGTTATTCTAATGATATTGGCAACAAATGCAGCGGTTGGAGTGATTACAGAAACAAACGCTGAAAAAGCTCGAGGTAAATTTGAAACCCTGATAAATTTTGAGCTCCAAGATGTTACTGATAATGATTTCATGTTTTCTACAACAAATTTCACTGATTTTGGATCGATATAG
Predicted protein sequences of Glyma18g41185
>Glyma18g41185.1   sequence type=predicted peptide   gene model=Glyma18g41185   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVLKQFDDLLVKILIVAALISFILALINGETGLMAFLEPSVILMILATNAAVGVITETNAEKARGKFETLINFELQDVTDNDFMFSTTNFTDFGSI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo