SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g41120

Feature Type:gene_model
Chromosome:Gm18
Start:49800105
stop:49805641
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g41120
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G02040AT Annotation by Michelle Graham. TAIR10: prenylated RAB acceptor 1.A1 | chr5:401163-402471 FORWARD LENGTH=209 SoyBaseE_val: 2.00E-110ISS
GO:0006869GO-bp Annotation by Michelle Graham. GO Biological Process: lipid transport SoyBaseN/AISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0006891GO-bp Annotation by Michelle Graham. GO Biological Process: intra-Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0010351GO-bp Annotation by Michelle Graham. GO Biological Process: lithium ion transport SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0016558GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG4050 KOG Glutamate transporter EAAC1-interacting protein GTRAP3-18 JGI ISS
PTHR12859Panther PRA1 PROTEIN JGI ISS
PF03208PFAM PRA1 family protein JGI ISS
UniRef100_D7M773UniRef Annotation by Michelle Graham. Most informative UniRef hit: Prenylated rab acceptor family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7M773_ARALL SoyBaseE_val: 1.00E-120ISS
UniRef100_UPI0001BA8718UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001BA8718 related cluster n=1 Tax=unknown RepID=UPI0001BA8718 SoyBaseE_val: 3.00E-146ISS

Expression Patterns of Glyma18g41120
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g41120
ParalogEvidenceComments
Glyma07g16630 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g41120 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g188700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g41120
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g41120
>Glyma18g41120.2   sequence type=CDS   gene model=Glyma18g41120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTGGGGAAACGTAACCGCGGAGGATCTGATCGACGCGCTCCGCGAGGTCGATTGGTCGTCGCCGCCGCGCCCGCTGTCGGAATTCTTCTCGCGATTCACTGTTCCCAGATCTTCCTCTAAATGGAACAGCCGCCTCAAATGCAACCTCTACTACTACCGGACCAACTACTTCATTTTGATTGTTTCTGTTCTCATATTGGGTTTTCTTCGAAGACCGCTAGCTATTGTAGCTGCACTTCTTACGGCACTCAGCATTGCTTTTCTGAATGACAGCTTTGCAGGTACCTTTAGTGAGAAGGTAACAAGAACAGTTAGGCAATTTTCACCACATTTAGCTGCCAAAATGAGACCTCCTCTCACGCCTGTTATTCGTGGACGTCCATCATCCAAGAGAGCAATTTATATATGTGGCCGGCCGCGTTGGGTATTTGTCTTGATATTTTCTTCTGCAAGTTTCTTTCTTTGGTTTGTTTCTGCTGGTCTCCTGACAGTTTTATGGGCTCTTGCTATTGGTCTTCTTGCTACCATCCTGCATGCAAGCTTTAGAACACCTAACTTGAAAGCTCGTCTAAACACATTCCGTGAAGAATTTCGTGCAGTATGGCGCAATTATAGTGAACTGTAG
Predicted protein sequences of Glyma18g41120
>Glyma18g41120.2   sequence type=predicted peptide   gene model=Glyma18g41120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDWGNVTAEDLIDALREVDWSSPPRPLSEFFSRFTVPRSSSKWNSRLKCNLYYYRTNYFILIVSVLILGFLRRPLAIVAALLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSSKRAIYICGRPRWVFVLIFSSASFFLWFVSAGLLTVLWALAIGLLATILHASFRTPNLKARLNTFREEFRAVWRNYSEL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo