SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g41090

Feature Type:gene_model
Chromosome:Gm18
Start:49747737
stop:49748185
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g41090
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G58080AT Annotation by Michelle Graham. TAIR10: ATP phosphoribosyl transferase 1 | chr1:21504562-21507429 REVERSE LENGTH=411 SoyBaseE_val: 3.00E-47ISS
GO:0000105GO-bp Annotation by Michelle Graham. GO Biological Process: histidine biosynthetic process SoyBaseN/AISS
GO:0006567GO-bp Annotation by Michelle Graham. GO Biological Process: threonine catabolic process SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0000287GO-mf Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding SoyBaseN/AISS
GO:0003879GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP phosphoribosyltransferase activity SoyBaseN/AISS
PF01634PFAM ATP phosphoribosyltransferase JGI ISS
UniRef100_G7JFL4UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATP phosphoribosyltransferase n=3 Tax=Medicago truncatula RepID=G7JFL4_MEDTR SoyBaseE_val: 2.00E-49ISS
UniRef100_UPI000233E288UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E288 related cluster n=1 Tax=unknown RepID=UPI000233E288 SoyBaseE_val: 3.00E-59ISS

Expression Patterns of Glyma18g41090
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g41090 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma18g41090
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g41090
>Glyma18g41090.1   sequence type=CDS   gene model=Glyma18g41090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CAGCTATCCAACCTCCAAGTTTGGTTTTGCAGGCCCAAAGACATCACAAGAAAATTGTTATCTGGAGATCTTGACCTTGGTATTGTTGGACTCGATAGTTTCACTGAACATGGCCAGGGTAGTGAAGATCTTATCATTGTCCACGAGGCTCTCGAGTATGGTGATTGTCATTCTACTCTTATTCCCCAATATGGAATATTTGAAAATGTAAATTCAGTGGACGAGCTTGCAAAAATGCCTCAATGGACAGAAGAAAAGCCTCTACGAGTTGCTATCGGTTTCACCTAT
Predicted protein sequences of Glyma18g41090
>Glyma18g41090.1   sequence type=predicted peptide   gene model=Glyma18g41090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
QLSNLQVWFCRPKDITRKLLSGDLDLGIVGLDSFTEHGQGSEDLIIVHEALEYGDCHSTLIPQYGIFENVNSVDELAKMPQWTEEKPLRVAIGFTY






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo