|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G58080 | AT | Annotation by Michelle Graham. TAIR10: ATP phosphoribosyl transferase 1 | chr1:21504562-21507429 REVERSE LENGTH=411 | SoyBase | E_val: 3.00E-47 | ISS |
GO:0000105 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histidine biosynthetic process | SoyBase | N/A | ISS |
GO:0006567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: threonine catabolic process | SoyBase | N/A | ISS |
GO:0019344 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process | SoyBase | N/A | ISS |
GO:0048767 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair elongation | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
GO:0000287 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding | SoyBase | N/A | ISS |
GO:0003879 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP phosphoribosyltransferase activity | SoyBase | N/A | ISS |
PF01634 | PFAM | ATP phosphoribosyltransferase | JGI | ISS | |
UniRef100_G7JFL4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: ATP phosphoribosyltransferase n=3 Tax=Medicago truncatula RepID=G7JFL4_MEDTR | SoyBase | E_val: 2.00E-49 | ISS |
UniRef100_UPI000233E288 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233E288 related cluster n=1 Tax=unknown RepID=UPI000233E288 | SoyBase | E_val: 3.00E-59 | ISS |
Glyma18g41090 not represented in the dataset |
Glyma18g41090 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g41090.1 sequence type=CDS gene model=Glyma18g41090 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high CAGCTATCCAACCTCCAAGTTTGGTTTTGCAGGCCCAAAGACATCACAAGAAAATTGTTATCTGGAGATCTTGACCTTGGTATTGTTGGACTCGATAGTTTCACTGAACATGGCCAGGGTAGTGAAGATCTTATCATTGTCCACGAGGCTCTCGAGTATGGTGATTGTCATTCTACTCTTATTCCCCAATATGGAATATTTGAAAATGTAAATTCAGTGGACGAGCTTGCAAAAATGCCTCAATGGACAGAAGAAAAGCCTCTACGAGTTGCTATCGGTTTCACCTAT
>Glyma18g41090.1 sequence type=predicted peptide gene model=Glyma18g41090 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high QLSNLQVWFCRPKDITRKLLSGDLDLGIVGLDSFTEHGQGSEDLIIVHEALEYGDCHSTLIPQYGIFENVNSVDELAKMPQWTEEKPLRVAIGFTY
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||