SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g40825): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g40825): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g40825

Feature Type:gene_model
Chromosome:Gm18
Start:49591396
stop:49591812
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g40825
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G17380AT Annotation by Michelle Graham. TAIR10: Thiamine pyrophosphate dependent pyruvate decarboxylase family protein | chr5:5724920-5726720 REVERSE LENGTH=572 SoyBaseE_val: 8.00E-51ISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0046482GO-bp Annotation by Michelle Graham. GO Biological Process: para-aminobenzoic acid metabolic process SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000287GO-mf Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004737GO-mf Annotation by Michelle Graham. GO Molecular Function: pyruvate decarboxylase activity SoyBaseN/AISS
GO:0016740GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity SoyBaseN/AISS
GO:0030976GO-mf Annotation by Michelle Graham. GO Molecular Function: thiamine pyrophosphate binding SoyBaseN/AISS
PTHR18968Panther THIAMINE PYROPHOSPHATE ENZYMES JGI ISS
PTHR18968:SF63Panther gb def: sulfoacetaldehyde sulfo-lyase [desulfonispora thiosulfatigenes] JGI ISS
PF02775PFAM Thiamine pyrophosphate enzyme, C-terminal TPP binding domain JGI ISS
UniRef100_D2D327UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pyruvate decarboxylase n=1 Tax=Gossypium hirsutum RepID=D2D327_GOSHI SoyBaseE_val: 4.00E-49ISS
UniRef100_UPI000233E287UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E287 related cluster n=1 Tax=unknown RepID=UPI000233E287 SoyBaseE_val: 1.00E-66ISS

Expression Patterns of Glyma18g40825
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g40825 not represented in the dataset
Glyma18g40825 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g40825 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g188400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g40825
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g40825
>Glyma18g40825.1   sequence type=CDS   gene model=Glyma18g40825   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CATGTTTGTGACACTTCATCTTTTATCCAGACGTTAGTTCGGTACCAGCTGCCTGTGGTCATCATTGTTTTCAACAATGGTGGTGTCCGTAGACACCCAGAGGAGATAGATGGACCTCACAAAGATGATCCTGGCCCCACAGATTTTGTCCCAAATGCAGGGTACCATGCTTTGATACAAGCTTTTGGTGGAAAGGGCTATCTTGTTGGGACGCGTGATGAACTCAAGTCCGCCTTTTCAGAATCCTTCTCTGCTAGGAAACCAGCTGTAGTAAATATTGTGATCGATCCCTATGCTGGTTCAGAGAGTGGGAGGATGCAACATAAGAATTGA
Predicted protein sequences of Glyma18g40825
>Glyma18g40825.1   sequence type=predicted peptide   gene model=Glyma18g40825   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
HVCDTSSFIQTLVRYQLPVVIIVFNNGGVRRHPEEIDGPHKDDPGPTDFVPNAGYHALIQAFGGKGYLVGTRDELKSAFSESFSARKPAVVNIVIDPYAGSESGRMQHKN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo