|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G49910 | AT | Annotation by Michelle Graham. TAIR10: Translation protein SH3-like family protein | chr3:18504311-18504751 FORWARD LENGTH=146 | SoyBase | E_val: 4.00E-58 | ISS |
| GO:0001510 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA methylation | SoyBase | N/A | ISS |
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005730 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleolus | SoyBase | N/A | ISS |
| GO:0005774 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0015934 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0022625 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit | SoyBase | N/A | ISS |
| GO:0022626 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome | SoyBase | N/A | ISS |
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
| KOG3401 | KOG | 60S ribosomal protein L26 | JGI | ISS | |
| PTHR11143 | Panther | 60S RIBOSOMAL PROTEIN L26 FAMILY MEMBER | JGI | ISS | |
| UniRef100_G7ILF2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L26-1 n=1 Tax=Medicago truncatula RepID=G7ILF2_MEDTR | SoyBase | E_val: 3.00E-56 | ISS |
| UniRef100_I1N2M7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1N2M7_SOYBN | SoyBase | E_val: 3.00E-81 | ISS |
|
Glyma18g40730 not represented in the dataset |
Glyma18g40730 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.18g187700 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g40730.2 sequence type=CDS gene model=Glyma18g40730 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCGTCACGTCCTAATGAGTGCGCCTCTCTCCACCGATCTCCGATCAAAGTACAACGCGTGGTCCATTCCGCTTCGCAAGGACGACGACGTTCAGGTTGTGAAAGGAACCTACAAGGGCCACGAGGGCAAAGTAGTCCAGCTTTATTTTTGTTTGTGGGTCATCCACATTGAGCACATCATCCGTGAGAAGGTTAACGGGTCCACCGTTAACGTTGGCATTCACCCTTCCAAGGTTGTCGTCACCAAGCTCCGAATTTACAAGGACCGCAAATTCTTGCTTGATTGGAAGGCCAAGGGTTGCGCCACTACTGACAAGGAAAAGGGTACCAAGTTTGCTCATGAGGATATCGTTTAG
>Glyma18g40730.2 sequence type=predicted peptide gene model=Glyma18g40730 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MRHVLMSAPLSTDLRSKYNAWSIPLRKDDDVQVVKGTYKGHEGKVVQLYFCLWVIHIEHIIREKVNGSTVNVGIHPSKVVVTKLRIYKDRKFLLDWKAKGCATTDKEKGTKFAHEDIV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||