SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g40541): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g40541): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g40541

Feature Type:gene_model
Chromosome:Gm18
Start:49173943
stop:49176164
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G06060AT Annotation by Michelle Graham. TAIR10: NAD(P)-binding Rossmann-fold superfamily protein | chr5:1824066-1825833 REVERSE LENGTH=264 SoyBaseE_val: 1.00E-47ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
KOG0725 KOG Reductases with broad range of substrate specificities JGI ISS
PTHR24310Panther FAMILY NOT NAMED JGI ISS
PTHR24310:SF66Panther JGI ISS
PF00106PFAM short chain dehydrogenase JGI ISS
UniRef100_B9T429UniRef Annotation by Michelle Graham. Most informative UniRef hit: Tropinone reductase, putative n=1 Tax=Ricinus communis RepID=B9T429_RICCO SoyBaseE_val: 4.00E-59ISS
UniRef100_I1KK25UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KK25_SOYBN SoyBaseE_val: 4.00E-85ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g40541 not represented in the dataset

Glyma18g40541 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g40541.1   sequence type=CDS   gene model=Glyma18g40541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGAACTAAAAATCGAAATGAAGATGGAAGAAGCAACAAAAATAATAACTGAAACAAAGTTGAGCTTTAACGACAAAAGATGGTCACTCCATGGAATGACTGCTCTAGTCACAGGAGGCACCCGAGGAATTTGCAAGGGACTTAATGTGACTGGTTCAGTGTGCGATCTACAGTGTTCTCACCAACGTAAAAGATTAATTGAAATTGTTGCCTCCATCTTTCAAGGAAAGCTCAATATTCTTAAAATAATGGATTACACTGTGGAAGATATATCAACCACTATGGGCACCAATTTTGAGTCATCTTATCATTTGTGTCAAGTTGCACACCCACTTCTAAAAGAATCTGGGCACGGGAGCGTAGTATTTATTTCGTCCATTGCAGGTTTAAGAGCTTTTCCATTTTTTTCTGCTTACGCAGCCTCTAAAGGAGCCATGAATCAATTCACCAAAAACTTAGCATTTGAATGGGCAAAGGATAATATCCGTGCAAATGCTGTCGCAGCTGGACCTGTTATGATTGTCCTTATGGAGGCTGTCAAG

>Glyma18g40541.1   sequence type=predicted peptide   gene model=Glyma18g40541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAELKIEMKMEEATKIITETKLSFNDKRWSLHGMTALVTGGTRGICKGLNVTGSVCDLQCSHQRKRLIEIVASIFQGKLNILKIMDYTVEDISTTMGTNFESSYHLCQVAHPLLKESGHGSVVFISSIAGLRAFPFFSAYAASKGAMNQFTKNLAFEWAKDNIRANAVAAGPVMIVLMEAVK







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo