SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g40521): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g40521): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g40521

Feature Type:gene_model
Chromosome:Gm18
Start:49157393
stop:49157749
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G10930AT Annotation by Michelle Graham. TAIR10: DNA helicase (RECQl4A) | chr1:3648032-3654997 REVERSE LENGTH=1188 SoyBaseE_val: 1.00E-29ISS
GO:0000724GO-bp Annotation by Michelle Graham. GO Biological Process: double-strand break repair via homologous recombination SoyBaseN/AISS
GO:0006260GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication SoyBaseN/AISS
GO:0006281GO-bp Annotation by Michelle Graham. GO Biological Process: DNA repair SoyBaseN/AISS
GO:0006310GO-bp Annotation by Michelle Graham. GO Biological Process: DNA recombination SoyBaseN/AISS
GO:0006974GO-bp Annotation by Michelle Graham. GO Biological Process: response to DNA damage stimulus SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0051276GO-bp Annotation by Michelle Graham. GO Biological Process: chromosome organization SoyBaseN/AISS
GO:0070417GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to cold SoyBaseN/AISS
GO:0071215GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to abscisic acid stimulus SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0004386GO-mf Annotation by Michelle Graham. GO Molecular Function: helicase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008026GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP-dependent helicase activity SoyBaseN/AISS
GO:0043138GO-mf Annotation by Michelle Graham. GO Molecular Function: 3'-5' DNA helicase activity SoyBaseN/AISS
GO:0043140GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP-dependent 3'-5' DNA helicase activity SoyBaseN/AISS
PTHR13710Panther DNA HELICASE RECQ FAMILY MEMBER JGI ISS
PTHR13710:SF13Panther RECQ HELICASE 5 JGI ISS
UniRef100_G7INR5UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATP-dependent DNA helicase Q1 (Fragment) n=1 Tax=Medicago truncatula RepID=G7INR5_MEDTR SoyBaseE_val: 6.00E-32ISS
UniRef100_I1KUN5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KUN5_SOYBN SoyBaseE_val: 4.00E-35ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g40521 not represented in the dataset

Glyma18g40521 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g186600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g40521.1   sequence type=CDS   gene model=Glyma18g40521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACTTAATTTTGATTATTGTAAATACAAGTTATTATATGTGACACCCGAAAAGGTTGCCAGAAGTGATAATCTTCTGCGTCACTTGGACAATTTACATTTTCGTGAATTGCTTGCAAGGATAGTAATTGATGAGGCTCACTGTGTGAGCCAATGGGGGCATGATTTTAGACTAGATTATCAGGTTAGAGCTTTGGTACCCTTCAAATTCATGCAAATCACATGA

>Glyma18g40521.1   sequence type=predicted peptide   gene model=Glyma18g40521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELNFDYCKYKLLYVTPEKVARSDNLLRHLDNLHFRELLARIVIDEAHCVSQWGHDFRLDYQVRALVPFKFMQIT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo