SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g39810): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g39810): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g39810

Feature Type:gene_model
Chromosome:Gm18
Start:47955929
stop:47957436
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G63490AT Annotation by Michelle Graham. TAIR10: transcription factor jumonji (jmjC) domain-containing protein | chr1:23544938-23551946 REVERSE LENGTH=1116 SoyBaseE_val: 1.00E-32ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006396GO-bp Annotation by Michelle Graham. GO Biological Process: RNA processing SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010413GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process SoyBaseN/AISS
GO:0016926GO-bp Annotation by Michelle Graham. GO Biological Process: protein desumoylation SoyBaseN/AISS
GO:0022402GO-bp Annotation by Michelle Graham. GO Biological Process: cell cycle process SoyBaseN/AISS
GO:0045492GO-bp Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process SoyBaseN/AISS
GO:0050665GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide biosynthetic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016706GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors SoyBaseN/AISS
UniRef100_G7KC36UniRef Annotation by Michelle Graham. Most informative UniRef hit: Lysine-specific demethylase 5D n=1 Tax=Medicago truncatula RepID=G7KC36_MEDTR SoyBaseE_val: 1.00E-66ISS
UniRef100_I1LGF8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LGF8_SOYBN SoyBaseE_val: 5.00E-90ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g39810 not represented in the dataset

Glyma18g39810 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g39810.1   sequence type=CDS   gene model=Glyma18g39810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TGGACTTTGGTGCTCATTGTTAGAGTTAGGTGGTTAACTGATACATCTTATTCAATAATCCTGTGGCCTTTAGTAGTAATCTTTCTAGTCTCTAAAAGAATTGACAAGGTTTTCTACAGTGATTATATGAATAAGTGGAGTACTAGTAATTTGGAATTTACTTATGTTGGAATCAGCTTCCTCAATTTCCTTGGCTTTTGTTACATAAATGTTTTTTTGCATGATGCATTTGTTACTACACTAAGGAAAGCTGAGCAATTTCTTTGGGCTAGTTCTGAGATGGATTCTTTTCGAGACATGGTAAAGAATTTGATTGAAGCTCAGAAGTGGGCAGAAGGGATAAGAGGCTGCGTAACAAAAATTGAGTTATGGTTGTGTCATCGGGACTCTAATGACAAGAAAGTTAATTTAGAATTCATTGATGAGTTACTGAAATTTACTCCTGCACCATGCAATGAACCTCTTTATCATAAATTGAAGGACTATGCAGAGGAAGCTAGGTTGTTAATTCAGGATATTGATACTGCTTTGTCAATGAGTTCAAATATGTCTGAGTTGGAACTTTTATACTCCAAAGCTTGTGGCCTACCCATCTACATGAAAGAAAGTAAGAAATTGGAAGGGAAGATTTCTTCAACCAAGGTAAATGTTGCCGTACATGATAGTTTGGCACATTATTTCAGCTTTCTGGTTGTGTGCTTAAGTTTCCATTTATATTGTTTATATTTTGAAACTATTTTTCTCTCCAAAGAGCGATTTTTTATTTACAAGGTCAGGGATCTGTAG

>Glyma18g39810.1   sequence type=predicted peptide   gene model=Glyma18g39810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
WTLVLIVRVRWLTDTSYSIILWPLVVIFLVSKRIDKVFYSDYMNKWSTSNLEFTYVGISFLNFLGFCYINVFLHDAFVTTLRKAEQFLWASSEMDSFRDMVKNLIEAQKWAEGIRGCVTKIELWLCHRDSNDKKVNLEFIDELLKFTPAPCNEPLYHKLKDYAEEARLLIQDIDTALSMSSNMSELELLYSKACGLPIYMKESKKLEGKISSTKVNVAVHDSLAHYFSFLVVCLSFHLYCLYFETIFLSKERFFIYKVRDL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo