Report for Sequence Feature Glyma18g39720
Feature Type: gene_model
Chromosome: Gm18
Start: 47783385
stop: 47784801
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g39720
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G62870 AT
Annotation by Michelle Graham. TAIR10: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein | chr3:23242862-23244273 REVERSE LENGTH=256
SoyBase E_val: 1.00E-31 ISS
GO:0001510 GO-bp
Annotation by Michelle Graham. GO Biological Process: RNA methylation
SoyBase N/A ISS
GO:0006412 GO-bp
Annotation by Michelle Graham. GO Biological Process: translation
SoyBase N/A ISS
GO:0042254 GO-bp
Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0005774 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0022625 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit
SoyBase N/A ISS
GO:0022626 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome
SoyBase N/A ISS
GO:0003735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome
SoyBase N/A ISS
PTHR26323 Panther
FAMILY NOT NAMED
JGI ISS
PTHR26323:SF1 Panther
SUBFAMILY NOT NAMED
JGI ISS
UniRef100_D7LTA6 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L7A n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LTA6_ARALL
SoyBase E_val: 7.00E-29 ISS
UniRef100_I1N2H0 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N2H0_SOYBN
SoyBase E_val: 2.00E-119 ISS
Expression Patterns of Glyma18g39720
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma18g39720 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma18g39720
Coding sequences of Glyma18g39720
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g39720.1 sequence type=CDS gene model=Glyma18g39720 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTCCCAAACGAGTGATTTTTTCTGTTTTGAAATCTCAAGAGAAGGTTTCAAATCTGCTGTTTGAGAAGCGTCCAAAGAAGTTCAGAATCGGAGGGGCGTTGCCTCCGAAGAGAGACTTGACTCGGTTCATGAAGTGGCCAAAGAATGTTCAAATTCAGAGGAAGAAGAGGATTCTGAAGCAAAGGTTGAAGGTTTCTCCAGCTTTGGACCAGTTCACCAAGACTCTTGACAAAAACCTAGGTCAGAATAACTTGCATAATTTGGGATTTGGATTGGAACATGATAAGCCTCCAACTAGTGCTTTGCCCTCACGAGGTGCATTAGGGTGTAGGGTACCCCACATGACATGCTTTGCCCTATTGTTAATTTCATCCTCTGCTTTTGCTATATTGTTTATGCTCATATGTTGTATTCTTAAGTCATTGATGTTTAGCTTTCCAATTCTTTTTTTTTTCCTGGCCAGTGTTTATGCTCATGTTCTCTTCAATGTGTTGTTTCTTGACCCTTTGCCTTAG
Predicted protein sequences of Glyma18g39720
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g39720.1 sequence type=predicted peptide gene model=Glyma18g39720 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAPKRVIFSVLKSQEKVSNLLFEKRPKKFRIGGALPPKRDLTRFMKWPKNVQIQRKKRILKQRLKVSPALDQFTKTLDKNLGQNNLHNLGFGLEHDKPPTSALPSRGALGCRVPHMTCFALLLISSSAFAILFMLICCILKSLMFSFPILFFFLASVYAHVLFNVLFLDPLP*