SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g39720): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g39720): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g39720

Feature Type:gene_model
Chromosome:Gm18
Start:47783385
stop:47784801
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g39720
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G62870AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein | chr3:23242862-23244273 REVERSE LENGTH=256 SoyBaseE_val: 1.00E-31ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PTHR26323Panther FAMILY NOT NAMED JGI ISS
PTHR26323:SF1Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_D7LTA6UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L7A n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LTA6_ARALL SoyBaseE_val: 7.00E-29ISS
UniRef100_I1N2H0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N2H0_SOYBN SoyBaseE_val: 2.00E-119ISS

Expression Patterns of Glyma18g39720
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g39720 not represented in the dataset
Glyma18g39720 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g39720 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma18g39720
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g39720
>Glyma18g39720.1   sequence type=CDS   gene model=Glyma18g39720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCCAAACGAGTGATTTTTTCTGTTTTGAAATCTCAAGAGAAGGTTTCAAATCTGCTGTTTGAGAAGCGTCCAAAGAAGTTCAGAATCGGAGGGGCGTTGCCTCCGAAGAGAGACTTGACTCGGTTCATGAAGTGGCCAAAGAATGTTCAAATTCAGAGGAAGAAGAGGATTCTGAAGCAAAGGTTGAAGGTTTCTCCAGCTTTGGACCAGTTCACCAAGACTCTTGACAAAAACCTAGGTCAGAATAACTTGCATAATTTGGGATTTGGATTGGAACATGATAAGCCTCCAACTAGTGCTTTGCCCTCACGAGGTGCATTAGGGTGTAGGGTACCCCACATGACATGCTTTGCCCTATTGTTAATTTCATCCTCTGCTTTTGCTATATTGTTTATGCTCATATGTTGTATTCTTAAGTCATTGATGTTTAGCTTTCCAATTCTTTTTTTTTTCCTGGCCAGTGTTTATGCTCATGTTCTCTTCAATGTGTTGTTTCTTGACCCTTTGCCTTAG
Predicted protein sequences of Glyma18g39720
>Glyma18g39720.1   sequence type=predicted peptide   gene model=Glyma18g39720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPKRVIFSVLKSQEKVSNLLFEKRPKKFRIGGALPPKRDLTRFMKWPKNVQIQRKKRILKQRLKVSPALDQFTKTLDKNLGQNNLHNLGFGLEHDKPPTSALPSRGALGCRVPHMTCFALLLISSSAFAILFMLICCILKSLMFSFPILFFFLASVYAHVLFNVLFLDPLP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo