SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g39561): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g39561): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g39561

Feature Type:gene_model
Chromosome:Gm18
Start:47608421
stop:47609169
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G16480AT Annotation by Michelle Graham. TAIR10: mitochondrial processing peptidase alpha subunit | chr3:5599906-5602716 FORWARD LENGTH=499 SoyBaseE_val: 3.00E-26ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005741GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial outer membrane SoyBaseN/AISS
GO:0005743GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane SoyBaseN/AISS
GO:0005750GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex III SoyBaseN/AISS
GO:0005758GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial intermembrane space SoyBaseN/AISS
GO:0005759GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial matrix SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004222GO-mf Annotation by Michelle Graham. GO Molecular Function: metalloendopeptidase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
PTHR11851Panther METALLOPROTEASE JGI ISS
PTHR11851:SF69Panther SUBFAMILY NOT NAMED JGI ISS
PF05193PFAM Peptidase M16 inactive domain JGI ISS
UniRef100_G7L7C9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial-processing peptidase subunit alpha n=1 Tax=Medicago truncatula RepID=G7L7C9_MEDTR SoyBaseE_val: 8.00E-42ISS
UniRef100_I1KPV1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KPV1_SOYBN SoyBaseE_val: 2.00E-44ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g39561 not represented in the dataset

Glyma18g39561 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g179700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g39561.1   sequence type=CDS   gene model=Glyma18g39561   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACCTCGGATAGTACTTGTAGCATCTGGTGTTGAACATGAGGAATTGTTATTTGTTGCAGAACCTCTCTTTTCTGATCTACCCAGTGTTCCACGTCTAGAGGAGCCAAAATCAATGTATACTGGTGGTGATTATAGATGTCAAAGTGAATCAGGGAGGACCCATTTTGCTCTAGCAGTTGAACTTCCTGGTGGCTGGCATAAGTTGAAGGATGCTATGGTTTTGACTATTCTTCAGGTTTTGATAATGTCTTACATTTTCTTGCTTTTCTGCACTTGA

>Glyma18g39561.1   sequence type=predicted peptide   gene model=Glyma18g39561   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPRIVLVASGVEHEELLFVAEPLFSDLPSVPRLEEPKSMYTGGDYRCQSESGRTHFALAVELPGGWHKLKDAMVLTILQVLIMSYIFLLFCT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo