Glyma18g39520 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g39520

Feature Type:	gene_model
Chromosome:	Gm18
Start:	47537729
stop:	47539660
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g39520

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G18010	AT	Annotation by Michelle Graham. TAIR10: WUSCHEL related homeobox 1 \| chr3:6161155-6163183 REVERSE LENGTH=350	SoyBase	E_val: 6.00E-28	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0048513	GO-bp	Annotation by Michelle Graham. GO Biological Process: organ development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
PF00046	PFAM	Homeobox domain	JGI		ISS
UniRef100_D9N1C1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: PRESSED FLOWER b n=1 Tax=Juncus wallichianus RepID=D9N1C1_9POAL	SoyBase	E_val: 2.00E-43	ISS
UniRef100_I1N2F8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N2F8_SOYBN	SoyBase	E_val: 6.00E-116	ISS

Expression Patterns of Glyma18g39520

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g39520

Paralog	Evidence	Comments
Glyma07g15710	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g39520 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g179300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g39520

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g39520

Limit To All Plant Sequences

>Glyma18g39520.2   sequence type=CDS   gene model=Glyma18g39520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTCCAGCAGGTTCATCAAGATGGAGCCCTACCACAGAACAGCTCATGATCTTGGAGGAACTGTACAGGAGTGGTATTAGAACTCCCAGTGCCTCTCAAATTCAGCAAATTACTACACACCTTTCTTTCTATGGCAGGATAGAAGGAAAGAACGTGTTCTACTGGTTTCAGAACCACAAGGCTAGGGATAGACAGAAGCTAAGAAGGAAACTCACCAAGCAACTGCAGCTACAGCAGCAGCAGCAACAACAACAATTCCAACTCCATCATCATTGCCAACAACTCAATCAAGATCATATCACTAACCATTTTGTTGGTAGCTTTGGTTATAGCACTGCTCGTTCTACTACCCATGATTTTTCCTTTTTTAACTCACCTAGCTTGATTTTTCAGGGAGGAGCTGCAAACACACCAGAACAAGCATTGAGTTGCAAATGGAATGTGCATAACCCTCAAAGTAATTTGGTGGAGAATAAAGAGATGGCATTCTGCAACTATGGTTGGACACTTGTGGATGTTGATAATCAAGCATCTTCATGTTGCACTACTCGACCTCTCAAGACTCTTGATCTCTTTCCTCTCACAACTACCAGAATCAATGAAGACTGCACCGCCACACCACCCAAGTAG

Predicted protein sequences of Glyma18g39520

Limit To All Plant Sequences

>Glyma18g39520.2   sequence type=predicted peptide   gene model=Glyma18g39520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSPAGSSRWSPTTEQLMILEELYRSGIRTPSASQIQQITTHLSFYGRIEGKNVFYWFQNHKARDRQKLRRKLTKQLQLQQQQQQQQFQLHHHCQQLNQDHITNHFVGSFGYSTARSTTHDFSFFNSPSLIFQGGAANTPEQALSCKWNVHNPQSNLVENKEMAFCNYGWTLVDVDNQASSCCTTRPLKTLDLFPLTTTRINEDCTATPPK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain