SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g39481

Feature Type:gene_model
Chromosome:Gm18
Start:47474410
stop:47476033
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g39481
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G52360AT Annotation by Michelle Graham. TAIR10: Coatomer, beta' subunit | chr1:19499420-19505397 FORWARD LENGTH=970 SoyBaseE_val: 7.00E-29ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0030117GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane coat SoyBaseN/AISS
GO:0030126GO-cc Annotation by Michelle Graham. GO Cellular Compartment: COPI vesicle coat SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
PTHR19876Panther COATOMER JGI ISS
PTHR19876:SF2Panther COATOMER ALPHA SUBUNIT JGI ISS
PF00400PFAM WD domain, G-beta repeat JGI ISS
UniRef100_A1YKF7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Coatomer complex subunit n=1 Tax=Brachypodium sylvaticum RepID=A1YKF7_BRASY SoyBaseE_val: 3.00E-26ISS
UniRef100_I1KV92UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KV92_SOYBN SoyBaseE_val: 1.00E-26ISS

Expression Patterns of Glyma18g39481
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g39481 not represented in the dataset
Glyma18g39481 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g39481 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g179100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g39481
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g39481
>Glyma18g39481.1   sequence type=CDS   gene model=Glyma18g39481   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAATAAAACCTTTGAAACAAGTATGGGATTATCAAACCAAAAGTTATGTTCAGACTCTAAAAGGTCACACACAATATGTATATGTTGTATGCTTTGATCCTGAACCATCTATAATCATTACTGGCTCTGAGGATGGCACAATGCGCATTTGGCATTCAACAACTTATAGGCATGAGAACACATTGAACTATGTTCTTCAAAGAGTTTGGGCACAGGTACGTTGCATAGATCTTTAA
Predicted protein sequences of Glyma18g39481
>Glyma18g39481.1   sequence type=predicted peptide   gene model=Glyma18g39481   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPIKPLKQVWDYQTKSYVQTLKGHTQYVYVVCFDPEPSIIITGSEDGTMRIWHSTTYRHENTLNYVLQRVWAQVRCIDL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo