Glyma18g39460 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g39460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g39460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g39460

Feature Type:	gene_model
Chromosome:	Gm18
Start:	47472034
stop:	47473326
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g39460

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G55200	AT	Annotation by Michelle Graham. TAIR10: Co-chaperone GrpE family protein \| chr5:22394705-22396335 FORWARD LENGTH=302	SoyBase	E_val: 3.00E-36	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0009411	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to UV	SoyBase	N/A	ISS
GO:0010583	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0000774	GO-mf	Annotation by Michelle Graham. GO Molecular Function: adenyl-nucleotide exchange factor activity	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0042803	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein homodimerization activity	SoyBase	N/A	ISS
GO:0051087	GO-mf	Annotation by Michelle Graham. GO Molecular Function: chaperone binding	SoyBase	N/A	ISS
PTHR21237	Panther	GRPE PROTEIN	JGI		ISS
PTHR21237:SF6	Panther	GRPE PROTEIN, MITOCHONDRIAL	JGI		ISS
PF01025	PFAM	GrpE	JGI		ISS
UniRef100_C6TCW7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TCW7_SOYBN	SoyBase	E_val: 2.00E-104	ISS
UniRef100_I1N0J3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GrpE protein homolog n=1 Tax=Glycine max RepID=I1N0J3_SOYBN	SoyBase	E_val: 9.00E-103	ISS

Expression Patterns of Glyma18g39460

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g39460 not represented in the dataset	Glyma18g39460 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g39460 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g39460

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g39460

Limit To All Plant Sequences

>Glyma18g39460.1   sequence type=CDS   gene model=Glyma18g39460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCTTCACCCTTTTCTCTGTTTCACGAAATTCCCAACCTTTCTCCACCACCCTGTCCAATAACTTCCATTCCCTCCTTCACCCATCTCCCAATAAGTTGATTCCGCTTCAAACCAATTTTCTGAATTCATCATTGACTTCGAGATTCGGGTTTTCTTCAATAGCCTCGCATGAGCATGCAAGTGAAGAAGCAAAGGTATCTGATCAGTCTGAACAAGCTGAAGCTGTGGATCAAACCAAAGAATCAGATGTAGAGAGTGAATGTGATCTATCCAGGGATGATTTGATAAAGCTTGTTGTTGAGAAGGAACAACTTTTGAAGTTGAAGCACAAGGAGATTGAGAAAATGCAGAGATGGAGAATGTCATGGATAGGACAAGAAAATTTTGCAAAGAGTTTACTAGATGTAGATGATAATTTGGGAAGAGCTTCCTCAGTTGTAAAGGACAGCTTTTCAAAAATTGAATCTCTTGAGGAGTCTTCTGAAGCAGCACAACTCCTAAAAACACTTCTAGAAGGTGTTGAAATGATAGAGAAACAACTTGCAGAG

Predicted protein sequences of Glyma18g39460

Limit To All Plant Sequences

>Glyma18g39460.1   sequence type=predicted peptide   gene model=Glyma18g39460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGFTLFSVSRNSQPFSTTLSNNFHSLLHPSPNKLIPLQTNFLNSSLTSRFGFSSIASHEHASEEAKVSDQSEQAEAVDQTKESDVESECDLSRDDLIKLVVEKEQLLKLKHKEIEKMQRWRMSWIGQENFAKSLLDVDDNLGRASSVVKDSFSKIESLEESSEAAQLLKTLLEGVEMIEKQLAE

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain