Glyma18g39440 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g39440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g39440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g39440

Feature Type:	gene_model
Chromosome:	Gm18
Start:	47422656
stop:	47425217
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g39440

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G29130	AT	Annotation by Michelle Graham. TAIR10: laccase 2 \| chr2:12525189-12527699 REVERSE LENGTH=573	SoyBase	E_val: 3.00E-27	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0046274	GO-bp	Annotation by Michelle Graham. GO Biological Process: lignin catabolic process	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0052716	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydroquinone:oxygen oxidoreductase activity	SoyBase	N/A	ISS
PTHR11709	Panther	MULTI-COPPER OXIDASE	JGI		ISS
PTHR11709:SF9	Panther	LACCASE	JGI		ISS
PF07732	PFAM	Multicopper oxidase	JGI		ISS
UniRef100_G7L1A9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Laccase n=1 Tax=Medicago truncatula RepID=G7L1A9_MEDTR	SoyBase	E_val: 2.00E-33	ISS
UniRef100_I1KZE6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KZE6_SOYBN	SoyBase	E_val: 1.00E-47	ISS

Expression Patterns of Glyma18g39440

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g39440 not represented in the dataset	Glyma18g39440 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g39440 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g39440

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g39440

Limit To All Plant Sequences

>Glyma18g39440.1   sequence type=CDS   gene model=Glyma18g39440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGCTCCTCCGATTCAATCATTTGCATTGCCAGCAATGTTTCTATTCTCATTGATCATCATACCCCAGCTTGCACTAGGGGGCATCACCAGGCACTACCATTTTGATGTAAAGTACCAAAATGTATCACGACTTTGCCATACAAAGAGCGTGGTCACAGTGAATGGTCAGTTTCCTGGGCCACGCATTGTAGCTAGGGAGGGTGACCGTCTTCTTATCAAAGTGACTAGCCATGTTCAGAACAATATCTCCATCCATTGGAGCAGAAATCACTGA

Predicted protein sequences of Glyma18g39440

Limit To All Plant Sequences

>Glyma18g39440.1   sequence type=predicted peptide   gene model=Glyma18g39440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGAPPIQSFALPAMFLFSLIIIPQLALGGITRHYHFDVKYQNVSRLCHTKSVVTVNGQFPGPRIVAREGDRLLIKVTSHVQNNISIHWSRNH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain