|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G67140 | AT | Annotation by Michelle Graham. TAIR10: F-box/RNI-like superfamily protein | chr5:26794009-26795213 REVERSE LENGTH=228 | SoyBase | E_val: 2.00E-29 | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| PTHR23125 | Panther | F-BOX/LEUCINE RICH REPEAT PROTEIN | JGI | ISS | |
| PTHR23125:SF103 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| UniRef100_C6SYX3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SYX3_SOYBN | SoyBase | E_val: 8.00E-43 | ISS |
| UniRef100_G7K5B9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: F-box protein n=1 Tax=Medicago truncatula RepID=G7K5B9_MEDTR | SoyBase | E_val: 1.00E-37 | ISS |
|
Glyma18g38291 not represented in the dataset |
Glyma18g38291 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g38291.1 sequence type=CDS gene model=Glyma18g38291 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGATGTTAAGGCAGAGATTGATCGCTTGCCAATTGACTTGTTGGCTCATATTTTTGTTTTGTTCACTTCCTTCATTGATTTGGCTCATATACGAGTGGCAAGTGGTGTTTGCAAGAAATGGAAACAAGGGGTGAAGGAGTCTCTTGCTCGAAGACACAATCTTAGCTTTACCGGTTGGAAGATGGATGATGACTCCACTGCTCACCTTGTTTATCACGCCTACAACCTCACTAAACTAGACATAGCTTTGGAGATGGATTGTATATTTGAGTTTATAAATTTTGATTGTACGAGGAATGGAGTTGGTAATTACTTTTGGTGA
>Glyma18g38291.1 sequence type=predicted peptide gene model=Glyma18g38291 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MDVKAEIDRLPIDLLAHIFVLFTSFIDLAHIRVASGVCKKWKQGVKESLARRHNLSFTGWKMDDDSTAHLVYHAYNLTKLDIALEMDCIFEFINFDCTRNGVGNYFW*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||