Glyma18g37700 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g37700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g37700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g37700

Feature Type:	gene_model
Chromosome:	Gm18
Start:	44913883
stop:	44916096
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g37700

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G52360	AT	Annotation by Michelle Graham. TAIR10: Coatomer, beta' subunit \| chr1:19499282-19505397 FORWARD LENGTH=926	SoyBase	E_val: 5.00E-57	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0007010	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization	SoyBase	N/A	ISS
GO:0010498	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0030117	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane coat	SoyBase	N/A	ISS
GO:0030126	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: COPI vesicle coat	SoyBase	N/A	ISS
GO:0005198	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural molecule activity	SoyBase	N/A	ISS
PTHR19876	Panther	COATOMER	JGI		ISS
PTHR19876:SF2	Panther	COATOMER ALPHA SUBUNIT	JGI		ISS
PF04053	PFAM	Coatomer WD associated region	JGI		ISS
UniRef100_I1M5M3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M5M3_SOYBN	SoyBase	E_val: 2.00E-61	ISS
UniRef100_Q5VQ78	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Coatomer subunit beta'-1 n=1 Tax=Oryza sativa Japonica Group RepID=COB21_ORYSJ	SoyBase	E_val: 5.00E-56	ISS

Expression Patterns of Glyma18g37700

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g37700 not represented in the dataset	Glyma18g37700 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g37700 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g37700

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g37700

Limit To All Plant Sequences

>Glyma18g37700.1   sequence type=CDS   gene model=Glyma18g37700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTAACTGTTATAGAGCTCTATATATACTTCTCTTTGTAACAGAAAACGCCACATATGCATTTGTCTCATTCTACATTCTGAAGTACAATCATGATGTTGTTATAGCATATTTAGATAATGGAAGACCTATAGATGATGAAGGTGTTGAAGATGCTTTTGAGCTCTTACATGAAATGAATGAACGTGTCAGGACAGGCATCTGGGTAGGGGATTGCTTTATCTACAACAATAATGTTTGGACACTTAATTACTGTGTTGGTGGTGAAGTATTAACTATTTTCCCTTCTATATTTTTACTCTCTTGGAGACTTAATTCCACTTCTTTTTGTTTTGTTCAAGACAAGTGTGATTTTACATTTAATTGTTACATCTATCTTTGCTTTGTGGCTCATTTTCTGGAATCACGAGGTATGATAGAAGATGCTCTTGAAGTAGCTACTGACCCTGACTACAGATTTGATCTAGCAATACAACTTGGAAAACTAGATGTTGCAAAGAGTATTGCAATAGAATTGCAGAGCGAGCGATTTTTTCTATCTAATTTGAATCTTCAACTAGATTATACAGGTTTTACTTATGGCCAGATTAAGATTTATTTCGTTGCATGTTACAACAAACACAACATTCAAAGACGATTATTATGTAATAACTGTCATAAAAAGCAATTTGGTTTTAACGATGTTATATACAATAACTGTCATAAAAAGCAATTTGGTTTTAACGATGTTATATACAACGACGGTTTACAACCGTCGTGA

Predicted protein sequences of Glyma18g37700

Limit To All Plant Sequences

>Glyma18g37700.1   sequence type=predicted peptide   gene model=Glyma18g37700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTNCYRALYILLFVTENATYAFVSFYILKYNHDVVIAYLDNGRPIDDEGVEDAFELLHEMNERVRTGIWVGDCFIYNNNVWTLNYCVGGEVLTIFPSIFLLSWRLNSTSFCFVQDKCDFTFNCYIYLCFVAHFLESRGMIEDALEVATDPDYRFDLAIQLGKLDVAKSIAIELQSERFFLSNLNLQLDYTGFTYGQIKIYFVACYNKHNIQRRLLCNNCHKKQFGFNDVIYNNCHKKQFGFNDVIYNDGLQPS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain