Glyma18g37635 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g37635

Feature Type:	gene_model
Chromosome:	Gm18
Start:	44879305
stop:	44879647
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g37635

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G30590	AT	Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 21 \| chr2:13033891-13035303 FORWARD LENGTH=380	SoyBase	E_val: 2.00E-17	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005516	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calmodulin binding	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
UniRef100_B9S4T8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: WRKY transcription factor, putative n=1 Tax=Ricinus communis RepID=B9S4T8_RICCO	SoyBase	E_val: 7.00E-30	ISS
UniRef100_I1L8A8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L8A8_SOYBN	SoyBase	E_val: 1.00E-52	ISS

Expression Patterns of Glyma18g37635

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g37635 not represented in the dataset	Glyma18g37635 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g37635 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g37635

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g37635

Limit To All Plant Sequences

>Glyma18g37635.1   sequence type=CDS   gene model=Glyma18g37635   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGAGGTTGAGCAAGCTAATAGAGTAGCTGTTGAAAGTTGCCATAGGGTTCTGAGTTTGTTGTCTCAACCAAGGGATCAGGTTCAGCGTAGGAATTTAATGGTGGAAACCAGTGAAACTGTGGTGAGGTTCAAGAAGGTTGTTTCCATGCTTCACAATGGTTTGGGTCATGCAAGAGTGAGGAAACTTAAAAACCCTCAAATCCCCTCTTCCCACCAAAGCATCTTCTTAGACAACCCCAATTGCAAAACCTTAACCAACAACAACAACAACAACAACCATCACTCAAAAAAAAATCTATACTTTCCCCAAATCAACTGA

Predicted protein sequences of Glyma18g37635

Limit To All Plant Sequences

>Glyma18g37635.1   sequence type=predicted peptide   gene model=Glyma18g37635   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEVEQANRVAVESCHRVLSLLSQPRDQVQRRNLMVETSETVVRFKKVVSMLHNGLGHARVRKLKNPQIPSSHQSIFLDNPNCKTLTNNNNNNNHHSKKNLYFPQIN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain