Glyma18g37620 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g37620

Feature Type:	gene_model
Chromosome:	Gm18
Start:	44872798
stop:	44873526
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g37620

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G74410	AT	Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein \| chr1:27965723-27967681 FORWARD LENGTH=223	SoyBase	E_val: 5.00E-21	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR22764	Panther	RING FINGER PROTEIN 11 (SID 1669) (NEDD4 WW DOMAIN-BINDING PROTEIN 2).	JGI		ISS
PF00097	PFAM	Zinc finger, C3HC4 type (RING finger)	JGI		ISS
UniRef100_G7K8K3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: RING finger family protein n=1 Tax=Medicago truncatula RepID=G7K8K3_MEDTR	SoyBase	E_val: 3.00E-49	ISS
UniRef100_I1N2A8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N2A8_SOYBN	SoyBase	E_val: 1.00E-82	ISS

Expression Patterns of Glyma18g37620

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g37620 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g37620

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g37620

Limit To All Plant Sequences

>Glyma18g37620.2   sequence type=CDS   gene model=Glyma18g37620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTAGCCCTATTGAGGAGTTTATTAAATGGAAAGCTATTTATGGAATGGATATGTCCAGCTGTTGCTCAAGCCTATCATTGCCATGTAAGGATAAATATTTACAATGACAATATTGTTAGGGAAATCACAATCGAAGGGGTGACTTGGAATATCATTCAAAAGCCTCCTGTTCAACAATTCAATTCCAGTAAAATGTTCAAATTATACAATGACTCTTGCTGCTCAATATGCTTCCAGGATTTTGAGGATGAAGAATTTGTGAGGACACTTCCAAAATGTGGCCACTTTTTTCACTTAGTCTGCATAGACAAATGGCTAGTCCAACAAGGATCATGCCCCATGTGTAGAATTTATGTTCCAGATTTATGA

Predicted protein sequences of Glyma18g37620

Limit To All Plant Sequences

>Glyma18g37620.2   sequence type=predicted peptide   gene model=Glyma18g37620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VALLRSLLNGKLFMEWICPAVAQAYHCHVRINIYNDNIVREITIEGVTWNIIQKPPVQQFNSSKMFKLYNDSCCSICFQDFEDEEFVRTLPKCGHFFHLVCIDKWLVQQGSCPMCRIYVPDL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain