SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g36684): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g36684): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g36684

Feature Type:gene_model
Chromosome:Gm18
Start:42999592
stop:43000131
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g36684
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G62710AT Annotation by Michelle Graham. TAIR10: beta vacuolar processing enzyme | chr1:23224070-23226857 REVERSE LENGTH=486 SoyBaseE_val: 2.00E-15ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0006624GO-bp Annotation by Michelle Graham. GO Biological Process: vacuolar protein processing SoyBaseN/AISS
GO:0004197GO-mf Annotation by Michelle Graham. GO Molecular Function: cysteine-type endopeptidase activity SoyBaseN/AISS
PTHR12000Panther HEMOGLOBINASE FAMILY MEMBER JGI ISS
PTHR12000:SF2Panther HEMOGLOBINASE JGI ISS
PF01650PFAM Peptidase C13 family JGI ISS
UniRef100_I1MUX2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MUX2_SOYBN SoyBaseE_val: 3.00E-38ISS
UniRef100_P49045UniRef Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar-processing enzyme n=1 Tax=Glycine max RepID=VPE_SOYBN SoyBaseE_val: 3.00E-38ISS

Expression Patterns of Glyma18g36684
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g36684 not represented in the dataset
Glyma18g36684 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g36684 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma18g36684
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g36684
>Glyma18g36684.1   sequence type=CDS   gene model=Glyma18g36684   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTTGCTGGTGAGAATGCACGGTGCAGCCACAAGACCAAACCAGAAGGAGTGGGACTCAGTCATAAAGTTACCGACCGAACCGGTGGATGCTGACTCGGATGAATTGCTAATAAAAGATGGACTAAAAGAAGAGAACATAGTGGTGTTTATGTACGATGACATAGCTACCAACGAGTTGAATCCTACACATGGAGTCATCATCAACCACCTTGAGGGAGAAGATCTGTATGCTGGTGTTCCTAAGGCAAGTTTTTTTTTTTTTTTTGGTTGA
Predicted protein sequences of Glyma18g36684
>Glyma18g36684.1   sequence type=predicted peptide   gene model=Glyma18g36684   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVLLVRMHGAATRPNQKEWDSVIKLPTEPVDADSDELLIKDGLKEENIVVFMYDDIATNELNPTHGVIINHLEGEDLYAGVPKASFFFFFG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo