|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G20020 | AT | Annotation by Michelle Graham. TAIR10: protein arginine methyltransferase 6 | chr3:6984055-6987945 REVERSE LENGTH=413 | SoyBase | E_val: 5.00E-11 | ISS |
| GO:0006479 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein methylation | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0008168 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity | SoyBase | N/A | ISS |
| GO:0008276 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein methyltransferase activity | SoyBase | N/A | ISS |
| PTHR11006 | Panther | PROTEIN ARGININE N-METHYLTRANSFERASE | JGI | ISS | |
| PTHR11006:SF43 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| UniRef100_D7LAV3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Arginine N-methyltransferase family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LAV3_ARALL | SoyBase | E_val: 2.00E-08 | ISS |
| UniRef100_I1NF35 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1NF35_SOYBN | SoyBase | E_val: 4.00E-16 | ISS |
|
Glyma18g36656 not represented in the dataset |
Glyma18g36656 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g36656.1 sequence type=CDS gene model=Glyma18g36656 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTTATTTACTATGCTGGACTACTGGTCTATGTTGAATGTCTATACTATCACATACTCCAAGTTGCATCTTCTTTTTATATTATTTTGGTCTCTCGGTTTGATAATTATGTTTTGCAGACTTTGATATACTTTTATGAGCCAATAGAACTGGAACAATATCAACTTATTGAAGGAAAAGTGACATTATCACAAAGCCAAGGAAACCACCGGAATTTGAATATTGAACTTGTATATGTATATTGGGCTTGA
>Glyma18g36656.1 sequence type=predicted peptide gene model=Glyma18g36656 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVIYYAGLLVYVECLYYHILQVASSFYIILVSRFDNYVLQTLIYFYEPIELEQYQLIEGKVTLSQSQGNHRNLNIELVYVYWA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||