Glyma18g36600 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g36600

Feature Type:	gene_model
Chromosome:	Gm18
Start:	42938975
stop:	42939322
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g36600

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G41475	AT	Annotation by Michelle Graham. TAIR10: Embryo-specific protein 3, (ATS3) \| chr2:17295259-17296329 REVERSE LENGTH=179	SoyBase	E_val: 6.00E-11	ISS
PF06232	PFAM	Embryo-specific protein 3, (ATS3)	JGI		ISS
UniRef100_I1N288	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N288_SOYBN	SoyBase	E_val: 1.00E-80	ISS
UniRef100_Q681K2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Embryo-specific protein 3, (ATS3) n=2 Tax=Arabidopsis thaliana RepID=Q681K2_ARATH	SoyBase	E_val: 3.00E-08	ISS

Expression Patterns of Glyma18g36600

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g36600 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g169500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g36600

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g36600

Limit To All Plant Sequences

>Glyma18g36600.1   sequence type=CDS   gene model=Glyma18g36600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCACCATAGAAACCACATGCACAAGGGGAGCTGAAACCTCGAACATTGTGAGCCTAAGGTTTGGGGACACAAACTCAAATGTCATATTGGTGAGGCACCTAAACTCCAAGCACCTAAGGAAAGTTGATCTATTGGAACCAGAGGTTCTCGATGACATGCCAAGAAAACCATTCCAAGCATGCATGGTGGACCAATTTGAGGTCACAGTACCATGTGTAAACTCCCCAATTTGTTACTTGTACCTCAAGCTAATTGGAAACGATGATTGGAGACCAGGTTTTGCACAAATTCAGGTTCTTGAAGGCTCACATCTTAACACCGATTACTTCTATTTTAGAAGATAG

Predicted protein sequences of Glyma18g36600

Limit To All Plant Sequences

>Glyma18g36600.1   sequence type=predicted peptide   gene model=Glyma18g36600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MITIETTCTRGAETSNIVSLRFGDTNSNVILVRHLNSKHLRKVDLLEPEVLDDMPRKPFQACMVDQFEVTVPCVNSPICYLYLKLIGNDDWRPGFAQIQVLEGSHLNTDYFYFRR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain