Report for Sequence Feature Glyma18g36530
Feature Type: gene_model
Chromosome: Gm18
Start: 42880190
stop: 42880529
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g36530
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G62950 AT
Annotation by Michelle Graham. TAIR10: RNA polymerase II, Rpb4, core protein | chr5:25262447-25263033 REVERSE LENGTH=106
SoyBase E_val: 1.00E-34 ISS
GO:0006351 GO-bp
Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent
SoyBase N/A ISS
GO:0044237 GO-bp
Annotation by Michelle Graham. GO Biological Process: cellular metabolic process
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0000166 GO-mf
Annotation by Michelle Graham. GO Molecular Function: nucleotide binding
SoyBase N/A ISS
GO:0003824 GO-mf
Annotation by Michelle Graham. GO Molecular Function: catalytic activity
SoyBase N/A ISS
GO:0003899 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity
SoyBase N/A ISS
PTHR15561 Panther
CALCITONIN GENE-RELATED PEPTIDE-RECEPTOR COMPONENT PROTEIN
JGI ISS
PF03874 PFAM
RNA polymerase Rpb4
JGI ISS
UniRef100_A8MS47 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: RNA polymerase II, Rpb4, core protein n=1 Tax=Arabidopsis thaliana RepID=A8MS47_ARATH
SoyBase E_val: 5.00E-32 ISS
UniRef100_I1N287 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1N287_SOYBN
SoyBase E_val: 2.00E-56 ISS
Expression Patterns of Glyma18g36530
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma18g36530 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g169400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g36530
Coding sequences of Glyma18g36530
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g36530.1 sequence type=CDS gene model=Glyma18g36530 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
GGCAATGCTGGTGCACTTACAAATTTTGAGGTCCTTGATTTCTTACAAGCTAAAGGAGCTTCAAAGGATCCAACAAGAGTTATTGCCAAAGTAGCGCAGTTTGAATACAAGGCTTATGATTATTTGGTTGACATTGCTGCCTCTGTTCATACAAGAGAGAGCATCAATGAGTTCTTGACAAGTGTTAAACAGCATGACCTGGCAAAAGCTGAGGCTCTGAACATATTAAACATTGGGCCAGCAGCTGATTTTGAACTATACCCA
Predicted protein sequences of Glyma18g36530
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g36530.1 sequence type=predicted peptide gene model=Glyma18g36530 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
GNAGALTNFEVLDFLQAKGASKDPTRVIAKVAQFEYKAYDYLVDIAASVHTRESINEFLTSVKQHDLAKAEALNILNIGPAADFELYP